| UniProt ID | OR2LD_HUMAN | |
|---|---|---|
| UniProt AC | Q8N349 | |
| Protein Name | Olfactory receptor 2L13 | |
| Gene Name | OR2L13 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 312 | |
| Subcellular Localization |
Cell membrane Multi-pass membrane protein. |
|
| Protein Description | Odorant receptor.. | |
| Protein Sequence | MEKWNHTSNDFILLGLLPPNQTGIFLLCLIILIFFLASVGNSAMIHLIHVDPRLHTPMYFLLSQLSLMDLMYISTTVPKMAYNFLSGQKGISFLGCGVQSFFFLTMACSEGLLLTSMAYDRYLAICHSLYYPIRMSKMMCVKMIGGSWTLGSINSLAHTVFALHIPYCRSRAIDHFFCDVPAMLLLACTDTWVYEYMVFVSTSLFLLFPFIGITSSCGRVLFAVYHMHSKEGRKKAFTTISTHLTVVIFYYAPFVYTYLRPRNLRSPAEDKILAVFYTILTPMLNPIIYSLRNKEVLGAMRRVFGIFSFLKE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 5 | N-linked_Glycosylation | ---MEKWNHTSNDFI ---CCCCCCCCCCEE | 39.36 | UniProtKB CARBOHYD | |
| 20 | N-linked_Glycosylation | LLGLLPPNQTGIFLL EECCCCCCHHHHHHH | 50.54 | UniProtKB CARBOHYD | |
| 122 | Phosphorylation | TSMAYDRYLAICHSL HHHHHHHHHHHHHHH | 9.51 | 25072903 | |
| 128 | Phosphorylation | RYLAICHSLYYPIRM HHHHHHHHHHHHHHH | 17.41 | 25072903 | |
| 130 | Phosphorylation | LAICHSLYYPIRMSK HHHHHHHHHHHHHHC | 15.37 | 26074081 | |
| 131 | Phosphorylation | AICHSLYYPIRMSKM HHHHHHHHHHHHHCC | 9.47 | 26074081 | |
| 136 | Phosphorylation | LYYPIRMSKMMCVKM HHHHHHHHCCEEEEE | 13.93 | 25072903 | |
| 277 | Phosphorylation | DKILAVFYTILTPML HHHHHHHHHHHHHHC | 6.05 | 24043423 | |
| 278 | Phosphorylation | KILAVFYTILTPMLN HHHHHHHHHHHHHCC | 9.69 | 24043423 | |
| 281 | Phosphorylation | AVFYTILTPMLNPII HHHHHHHHHHCCHHH | 11.64 | 24043423 | |
| 289 | Phosphorylation | PMLNPIIYSLRNKEV HHCCHHHHHHCCHHH | 11.45 | 24043423 | |
| 290 | Phosphorylation | MLNPIIYSLRNKEVL HCCHHHHHHCCHHHH | 15.50 | 24719451 | |
| 308 | Phosphorylation | RRVFGIFSFLKE--- HHHHHHHHHHCC--- | 27.96 | 24719451 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of OR2LD_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of OR2LD_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of OR2LD_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of OR2LD_HUMAN !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
