| UniProt ID | OPSX_MOUSE | |
|---|---|---|
| UniProt AC | O35214 | |
| Protein Name | Visual pigment-like receptor peropsin | |
| Gene Name | Rrh | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 337 | |
| Subcellular Localization |
Membrane Multi-pass membrane protein. |
|
| Protein Description | May play a role in rpe physiology either by detecting light directly or by monitoring the concentration of retinoids or other photoreceptor-derived compounds.. | |
| Protein Sequence | MLSEASDFNSSGSRSEGSVFSRTEHSVIAAYLIVAGITSILSNVVVLGIFIKYKELRTPTNAVIINLAFTDIGVSSIGYPMSAASDLHGSWKFGHAGCQIYAGLNIFFGMVSIGLLTVVAMDRYLTISCPDVGRRMTTNTYLSMILGAWINGLFWALMPIIGWASYAPDPTGATCTINWRNNDTSFVSYTMMVIVVNFIVPLTVMFYCYYHVSRSLRLYAASDCTAHLHRDWADQADVTKMSVIMILMFLLAWSPYSIVCLWACFGNPKKIPPSMAIIAPLFAKSSTFYNPCIYVAAHKKFRKAMLAMFKCQPHLAVPEPSTLPMDMPQSSLAPVRI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 9 | N-linked_Glycosylation | LSEASDFNSSGSRSE CCCCCCCCCCCCCCC | 40.01 | - | |
| 23 | Phosphorylation | EGSVFSRTEHSVIAA CCCCCCCCCHHHHHH | 36.53 | - | |
| 26 | Phosphorylation | VFSRTEHSVIAAYLI CCCCCCHHHHHHHHH | 14.69 | - | |
| 182 | N-linked_Glycosylation | CTINWRNNDTSFVSY EEEECCCCCCCCCEE | 45.42 | - | |
| 207 | Phosphorylation | VPLTVMFYCYYHVSR HHHHHHHHHHHHHHH | 2.15 | - | |
| 284 | Other | IIAPLFAKSSTFYNP HHHHHHHCCCCCCCC | 37.29 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of OPSX_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of OPSX_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of OPSX_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of OPSX_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
