OP24A_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: OP24A_ARATH
• UniProt AC: Q1H5C9
• Protein Name: Outer envelope pore protein 24A, chloroplastic
• Gene Name: OEP24A
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 213
• Subcellular Localization: Plastid, etioplast membrane; Multi-pass membrane protein. Plastid, chloroplast outer membrane; Multi-pass membrane protein. Present in non-green root plastids..
• Protein Description: High-conductance voltage-dependent solute channel with a slight selectivity for cations transporting triosephosphates, dicarboxylic acids, ATP, inorganic phosphate (Pi), sugars, and positively or negatively charged amino acids..
• Protein Sequence: MMKASFKGKFDVDKSGSVASLTFNAGNAKLRATMTDASFVAGPSFNGLSLAVEKPGFFIIDYNVPKKDVRFQFMNTIRIAEKPLNLTYIHMRGDNRTIVDGSFVIDPANKLSANYMVGTKNCKLKYTYVHGGIATFEPCYDVAKNMWDFAISHKLYGGDNLKATYQTSSKMLGLEWSNNSKSTGSFKVCASMNLAEELKPPKLTAETTWNLEL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of OP24A_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of OP24A_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of OP24A_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of OP24A_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CNG13_ARATH	CNGC13	physical	22737156

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.