dbPTM

OP161_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	OP161_ARATH
UniProt AC	Q9ZV24
Protein Name	Outer envelope pore protein 16-1, chloroplastic
Gene Name	OEP161
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	148
Subcellular Localization	Plastid, chloroplast outer membrane Multi-pass membrane protein. Plastid, etioplast membrane Multi-pass membrane protein.
Protein Description	Voltage-dependent high-conductance channel with a slight cation-selectivity; selective for amino acids but excludes triosephosphates or uncharged sugars (By similarity). Non-essential amino acid-selective channel protein and translocation pore for NADPH:protochlorophyllide oxidoreductase A (PORA) and possibly PORB. Involved in PORA precursor (pPORA) import and thus confers photoprotection onto etiolated seedlings during greening..
Protein Sequence	MPSSTFSGTVSTPKLSVAVDMGNPFLNLTVDAFLKIGAVGVTKSLAEDTYKAIDKGSLSKSTLEHALKKLCKEGVYWGAAGGVYIGTEYGIERIRGSRDWKNAMLAGAATGAVLSAVGKKGKDTIVIDAILGGALATASQFVNNHYFY

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
4	Phosphorylation	----MPSSTFSGTVS ----CCCCCCCCEEC	27.83	30291188
57	Phosphorylation	YKAIDKGSLSKSTLE HHHHHCCCCCHHHHH	34.90	25561503

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of OP161_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of OP161_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of OP161_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
NAC89_ARATH	NAC089	physical	21798944

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of OP161_ARATH

Related Literatures of Post-Translational Modification