UniProt ID | ONCO_HUMAN | |
---|---|---|
UniProt AC | P0CE72 | |
Protein Name | Oncomodulin-1 | |
Gene Name | OCM | |
Organism | Homo sapiens (Human). | |
Sequence Length | 109 | |
Subcellular Localization | ||
Protein Description | Has some calmodulin-like activity with respect to enzyme activation and growth regulation. Binds two calcium ions.. | |
Protein Sequence | MSITDVLSADDIAAALQECRDPDTFEPQKFFQTSGLSKMSANQVKDVFRFIDNDQSGYLDEEELKFFLQKFESGARELTESETKSLMAAADNDGDGKIGAEEFQEMVHS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MSITDVLSA ------CCHHHHCCH | 33.91 | - | |
24 | Phosphorylation | QECRDPDTFEPQKFF HHCCCCCCCCCHHHH | 34.97 | 28787133 | |
37 | Phosphorylation | FFQTSGLSKMSANQV HHHCCCCCCCCHHHH | 29.82 | 26434776 | |
73 | Phosphorylation | FFLQKFESGARELTE HHHHHHHHCCCCCCH | 40.67 | - | |
79 | Phosphorylation | ESGARELTESETKSL HHCCCCCCHHHHHHH | 32.48 | - | |
81 | Phosphorylation | GARELTESETKSLMA CCCCCCHHHHHHHHH | 45.38 | - | |
83 | Phosphorylation | RELTESETKSLMAAA CCCCHHHHHHHHHHH | 34.90 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ONCO_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ONCO_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ONCO_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of ONCO_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...