| UniProt ID | OLEO1_ARATH | |
|---|---|---|
| UniProt AC | P29525 | |
| Protein Name | Oleosin 18.5 kDa | |
| Gene Name | At4g25140 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 173 | |
| Subcellular Localization |
Lipid droplet. Membrane Multi-pass membrane protein. Surface of oil bodies. Oleosins exist at a monolayer lipid/water interface. |
|
| Protein Description | May have a structural role to stabilize the lipid body during desiccation of the seed by preventing coalescence of the oil. Probably interacts with both lipid and phospholipid moieties of lipid bodies. May also provide recognition signals for specific lipase anchorage in lipolysis during seedling growth.. | |
| Protein Sequence | MADTARGTHHDIIGRDQYPMMGRDRDQYQMSGRGSDYSKSRQIAKAATAVTAGGSLLVLSSLTLVGTVIALTVATPLLVIFSPILVPALITVALLITGFLSSGGFGIAAITVFSWIYKYATGEHPQGSDKLDSARMKLGSKAQDLKDRAQYYGQQHTGGEHDRDRTRGGQHTT | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 8 | Phosphorylation | MADTARGTHHDIIGR CCCCCCCCCCCCCCC | 15.52 | 27288362 | |
| 18 | Phosphorylation | DIIGRDQYPMMGRDR CCCCCCCCCCCCCCH | 9.44 | 27288362 | |
| 31 | Phosphorylation | DRDQYQMSGRGSDYS CHHHHHCCCCCCCHH | 15.15 | 27288362 | |
| 133 | Phosphorylation | QGSDKLDSARMKLGS CCCCHHHHHHHHHCC | 28.36 | 27288362 | |
| 140 | Phosphorylation | SARMKLGSKAQDLKD HHHHHHCCCHHHHHH | 34.94 | 27288362 | |
| 157 | Phosphorylation | QYYGQQHTGGEHDRD HHHHCCCCCCCCCCC | 42.41 | 27288362 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of OLEO1_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of OLEO1_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of OLEO1_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| UBQ3_ARATH | UBQ3 | physical | 25907570 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
