dbPTM

OEP37_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	OEP37_ARATH
UniProt AC	O80565
Protein Name	Outer envelope pore protein 37, chloroplastic
Gene Name	OEP37
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	343
Subcellular Localization	Plastid, chloroplast outer membrane Multi-pass membrane protein .
Protein Description	Voltage-dependent peptide-sensitive high conductance rectifying cation channel with a strong affinity for TIC32 that is imported into the chloroplast. Conductance is pH-dependent decreasing with decreasing pH values..
Protein Sequence	MADPSSQNPNLATPPPPSSPSPTHQIQSGTSELSPPSRPPCSTLSFLKTANRPKLRVTSEFDSDSLLFLNKVSCKLFDNLAKLKLSFQNNSQREISQPQVSFTSKHVSVLYDVEEKNTFIKSTLDVHPRLQLRALHNVKAQQGEVAMEANLTEPGYSLELSSPVPIGYPRATLKFPLGEISLQEKDEEEEEKQKRTLSVNGILKRQVMNGVCTALYTDEELRLRYAYKDDALSFIPSISLPSNAASFAFKRRFSPSDKLSYWYNFDSNMWSAVYKRTYGKDYKLKAGYDSDVRLGWASLWVGDEAGKVKTTPMKMKVQFMLQVPQDDIKSSVLMFRVKKRWDI

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
246	Phosphorylation	SLPSNAASFAFKRRF CCCCCHHHHHHHCCC	18.07	19880383

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of OEP37_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of OEP37_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of OEP37_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of OEP37_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of OEP37_ARATH

Related Literatures of Post-Translational Modification