| UniProt ID | ODBB_MOUSE | |
|---|---|---|
| UniProt AC | Q6P3A8 | |
| Protein Name | 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial | |
| Gene Name | Bckdhb | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 390 | |
| Subcellular Localization | Mitochondrion matrix. | |
| Protein Description | The branched-chain alpha-keto dehydrogenase complex catalyzes the overall conversion of alpha-keto acids to acyl-CoA and CO(2). It contains multiple copies of three enzymatic components: branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2) and lipoamide dehydrogenase (E3).. | |
| Protein Sequence | MAAVAARAGGLLWLRAAGAERRRCGLRCAALVQGFLQPGGEDTAQKRRVAHFTFHPDPESLQYGQTQKMNLFQSITSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRAPWGCVGHGALYHSQSPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAAVEQVPVEPYKIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAQEKLGVSCEVIDLRTIVPWDVDTVCKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHIFEPFYIPDKWKCYDALRKMINY | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 68 | Acetylation | LQYGQTQKMNLFQSI CCCCCHHHCCHHHHH | 32.89 | 23954790 | |
| 175 | S-nitrosocysteine | RSGDLFNCGSLTIRA CCCCCEECCEEEEEC | 2.84 | - | |
| 175 | S-nitrosylation | RSGDLFNCGSLTIRA CCCCCEECCEEEEEC | 2.84 | 21278135 | |
| 175 | S-palmitoylation | RSGDLFNCGSLTIRA CCCCCEECCEEEEEC | 2.84 | 28526873 | |
| 226 | S-palmitoylation | AKGLLLSCIEDKNPC CCCHHHHHHCCCCCE | 3.89 | 28526873 | |
| 230 | Acetylation | LLSCIEDKNPCIFFE HHHHHCCCCCEEEEC | 50.42 | 23576753 | |
| 233 | S-palmitoylation | CIEDKNPCIFFEPKI HHCCCCCEEEECHHH | 6.23 | 28526873 | |
| 239 | Acetylation | PCIFFEPKILYRAAV CEEEECHHHHHEEHH | 37.84 | 23576753 | |
| 292 | Acetylation | VASMAQEKLGVSCEV HHHHHHHHHCCCEEE | 38.16 | 23864654 | |
| 292 | Succinylation | VASMAQEKLGVSCEV HHHHHHHHHCCCEEE | 38.16 | 24315375 | |
| 297 | S-nitrosocysteine | QEKLGVSCEVIDLRT HHHHCCCEEEEECCC | 4.50 | - | |
| 297 | S-nitrosylation | QEKLGVSCEVIDLRT HHHHCCCEEEEECCC | 4.50 | 21278135 | |
| 314 | S-palmitoylation | PWDVDTVCKSVIKTG CCCHHHHHHHHHHHC | 2.70 | 28526873 | |
| 315 | Acetylation | WDVDTVCKSVIKTGR CCHHHHHHHHHHHCC | 43.34 | 23864654 | |
| 380 | S-nitrosocysteine | YIPDKWKCYDALRKM CCCCHHHHHHHHHHH | 3.45 | - | |
| 380 | S-nitrosylation | YIPDKWKCYDALRKM CCCCHHHHHHHHHHH | 3.45 | 21278135 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ODBB_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ODBB_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ODBB_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of ODBB_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
