UniProt ID | OCTL_DROME | |
---|---|---|
UniProt AC | Q95R48 | |
Protein Name | Organic cation transporter-like protein | |
Gene Name | Orct2 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 567 | |
Subcellular Localization |
Membrane Multi-pass membrane protein. |
|
Protein Description | Probably transports organic cations.. | |
Protein Sequence | MGYDEAIIHLGDFGRYQKIIYFLICLTSIPVAFHKLAGVFLLAKPDFRCALPFENGSSYDLPTHLWNLSYPENERCSYYDVDYTEEYLNGSIPRSSNETKTCSSYVYDRSKYLNSAVTEWNLVCGRDFMAATSDSLFMLGVLLGSIVFGQLSDKYGRKPILFASLVIQVLFGVLAGVAPEYFTYTFARLMVGATTSGVFLVAYVVAMEMVGPDKRLYAGIFVMMFFSVGFMLTAVFAYFVHDWRWLQIALTLPGLIFMFYYWIIPESARWLLLKGRKDCAIANMQKAARFNKVEISDEALSELLDEGENSEEKAKQKLEDQELDEGPPPSVWDLFCYPNLRRKTLLIFLDWLVTSGVYYGLSWNTSNLGGNVLLNFVISGAVEIPAYIFLLLTLNRWGRRSILCGCLVMAGLSLLATVIIPQRMHTLIVACAMLGKLAITASYGTVYIFSAEQFPTVVRNVALGAASMVARISGMMAPFLNFLATIWKPLPLLICGSLTLVAGLLSLLLPETHNKPMLETIADGERFGKKTKADVYLETGQELRAPEAQPLKGSGETNGSTIANGHK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
55 | N-linked_Glycosylation | RCALPFENGSSYDLP EEECCCCCCCCCCCC | 56.90 | - | |
67 | N-linked_Glycosylation | DLPTHLWNLSYPENE CCCCCHHCCCCCCCC | 26.01 | - | |
89 | N-linked_Glycosylation | DYTEEYLNGSIPRSS CCCHHHHCCCCCCCC | 41.06 | - | |
97 | N-linked_Glycosylation | GSIPRSSNETKTCSS CCCCCCCCCCCCCCH | 63.30 | - | |
296 | Phosphorylation | RFNKVEISDEALSEL HCCCCCCCHHHHHHH | 18.85 | 19429919 | |
301 | Phosphorylation | EISDEALSELLDEGE CCCHHHHHHHHHCCC | 32.99 | 19429919 | |
310 | Phosphorylation | LLDEGENSEEKAKQK HHHCCCCHHHHHHHH | 42.71 | 19429919 | |
536 | Phosphorylation | KKTKADVYLETGQEL CCCCCCEECCCCCCC | 10.20 | 19429919 | |
554 | Phosphorylation | EAQPLKGSGETNGST CCCCCCCCCCCCCCC | 31.69 | 19429919 | |
557 | Phosphorylation | PLKGSGETNGSTIAN CCCCCCCCCCCCCCC | 48.70 | 19429919 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of OCTL_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of OCTL_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of OCTL_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...