UniProt ID | OCM2_HUMAN | |
---|---|---|
UniProt AC | P0CE71 | |
Protein Name | Putative oncomodulin-2 | |
Gene Name | OCM2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 109 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MSITDVLSADDIAAALQECQDPDTFEPQKFFQTSGLSKMSASQVKDVFRFIDNDQSGYLDEEELKFFLQKFESGARELTESETKSLMAAADNDGDGKIGAEEFQEMVHS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
37 | Phosphorylation | FFQTSGLSKMSASQV HHCCCCCCCCCHHHH | 29.82 | 26434776 | |
40 | Phosphorylation | TSGLSKMSASQVKDV CCCCCCCCHHHHHHH | 28.62 | 24702127 | |
42 | Phosphorylation | GLSKMSASQVKDVFR CCCCCCHHHHHHHHH | 28.35 | 24702127 | |
73 | Phosphorylation | FFLQKFESGARELTE HHHHHHHHCCCCCCH | 40.67 | - | |
79 | Phosphorylation | ESGARELTESETKSL HHCCCCCCHHHHHHH | 32.48 | - | |
81 | Phosphorylation | GARELTESETKSLMA CCCCCCHHHHHHHHH | 45.38 | - | |
83 | Phosphorylation | RELTESETKSLMAAA CCCCHHHHHHHHHHH | 34.90 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of OCM2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of OCM2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of OCM2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of OCM2_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...