dbPTM

OC90_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	OC90_MOUSE
UniProt AC	Q9Z0L3
Protein Name	Otoconin-90
Gene Name	Oc90
Organism	Mus musculus (Mouse).
Sequence Length	485
Subcellular Localization	Secreted.
Protein Description	Major protein of the utricular and saccular otoconia. It is unlikely that this protein has phospholipase A2 activity..
Protein Sequence	MIMLLMVGMLMAPCVGAHALDTPNPQELPPGLSKNINITFFNGVFKNVESVAEIFDCLGSHFTWLQAVFTNFPLLLQFVNSMRCVTGLCPRDFEDYGCACRFEMEGMPVDESDICCFQHRRCYEEAVEMDCLQDPAKLSADVDCTNKQITCESEDPCERLLCTCDKAAVECLAQSGINSSLNFLDASFCLPQTPETTSGKAATLLPRGIPEKPTDTSQIALSGEVAGEVRADTLTTLSRTKSVQDLQDTQASRTTSSPGSAEIIALAKGTTHSAGIKPLRLGVSSVDNGSQEAAGKACDRLAFVHLGDGDSMTAMLQLGEMLFCLTSHCPEEFETYGCYCGREGRGEPRDTLDRCCLSHHCCLEQMRQVGCLHGRRSQSSVVCEDHMAKCVGQSLCEKLLCACDQMAAECMASAFFNQSLKSPDGAECQGEPVSCEDGMLQGTLASSVDSSSEENSEEAPPQMERLRRFLEKPPGPLGARPLGGK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
37	N-linked_Glycosylation	PGLSKNINITFFNGV CCCCCCCEEEEECCC	36.32	-
178	N-linked_Glycosylation	CLAQSGINSSLNFLD HHHHCCCCCCCCCCC	29.13	-
288	N-linked_Glycosylation	LGVSSVDNGSQEAAG ECCEECCCCCHHHHH	50.27	-
290	Phosphorylation	VSSVDNGSQEAAGKA CEECCCCCHHHHHHH	30.97	29899451
413	Phosphorylation	MAAECMASAFFNQSL HHHHHHHHHHHCCCC	9.95	23140645
417	N-linked_Glycosylation	CMASAFFNQSLKSPD HHHHHHHCCCCCCCC	24.87	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of OC90_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of OC90_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of OC90_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of OC90_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of OC90_MOUSE

Related Literatures of Post-Translational Modification