OBRG_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: OBRG_HUMAN
• UniProt AC: O15243
• Protein Name: Leptin receptor gene-related protein
• Gene Name: LEPROT
• Organism: Homo sapiens (Human).
• Sequence Length: 131
• Subcellular Localization: Golgi apparatus membrane; Multi-pass membrane protein. Endosome membrane.
• Protein Description: Negatively regulates leptin receptor (LEPR) cell surface expression, and thus decreases response to leptin. Negatively regulates growth hormone (GH) receptor cell surface expression in liver. May play a role in liver resistance to GH during periods of reduced nutrient availability..
• Protein Sequence: MAGVKALVALSFSGAIGLTFLMLGCALEDYGVYWPLFVLIFHAISPIPHFIAKRVTYDSDATSSACRELAYFFTTGIVVSAFGFPVILARVAVIKWGACGLVLAGNAVIFLTIQGFFLIFGRGDDFSWEQW

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
66	S-palmitoylation	SDATSSACRELAYFF CCCCHHHHHHHHHHH	3.62	29575903

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of OBRG_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of OBRG_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of OBRG_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of OBRG_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.