UniProt ID | OAZ_SCHPO | |
---|---|---|
UniProt AC | Q9USQ5 | |
Protein Name | Ornithine decarboxylase antizyme | |
Gene Name | spa1 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 226 | |
Subcellular Localization | ||
Protein Description | Ornithine decarboxylase (ODC) antizyme protein that negatively regulates ODC activity and intracellular polyamine biosynthesis in response to increased intracellular polyamine levels. Binds to ODC monomers, inhibiting the assembly of the functional ODC homodimer, and targets the monomers for ubiquitin-independent proteolytic destruction by the 26S proteasome.. | |
Protein Sequence | MAFRNRMYQLSNVDDADADILNSHFAPNPRGQNHTHGRRRNTLALCTTKDQMFVYGSTPAGGAEWCSEALERSRPRAAFKQQRRRHVPRWISDSFRTCLPKPSGILKEQTVNEEEGNSRHRGKYDCDERIGVAESMNYWHGIVRTEEDGSKTLFLIPESWEDVHLKEGLVAIIDLAVDRLHCSKLVLFVDKNNSSLPYLVKSLHWVGFEPLPHLNCSDHALFGMEL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of OAZ_SCHPO !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of OAZ_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of OAZ_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of OAZ_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of OAZ_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...