dbPTM

OAZ_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	OAZ_SCHPO
UniProt AC	Q9USQ5
Protein Name	Ornithine decarboxylase antizyme
Gene Name	spa1
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	226
Subcellular Localization
Protein Description	Ornithine decarboxylase (ODC) antizyme protein that negatively regulates ODC activity and intracellular polyamine biosynthesis in response to increased intracellular polyamine levels. Binds to ODC monomers, inhibiting the assembly of the functional ODC homodimer, and targets the monomers for ubiquitin-independent proteolytic destruction by the 26S proteasome..
Protein Sequence	MAFRNRMYQLSNVDDADADILNSHFAPNPRGQNHTHGRRRNTLALCTTKDQMFVYGSTPAGGAEWCSEALERSRPRAAFKQQRRRHVPRWISDSFRTCLPKPSGILKEQTVNEEEGNSRHRGKYDCDERIGVAESMNYWHGIVRTEEDGSKTLFLIPESWEDVHLKEGLVAIIDLAVDRLHCSKLVLFVDKNNSSLPYLVKSLHWVGFEPLPHLNCSDHALFGMEL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of OAZ_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of OAZ_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of OAZ_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of OAZ_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of OAZ_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of OAZ_SCHPO

Related Literatures of Post-Translational Modification