UniProt ID | OAF_DROME | |
---|---|---|
UniProt AC | Q9NLA6 | |
Protein Name | Out at first protein | |
Gene Name | oaf | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 487 | |
Subcellular Localization | ||
Protein Description | Vital for proper neuronal development and hatching.. | |
Protein Sequence | MILKEEHPHQSIETAANAARQAQVRWRMAHLKALSRTRTPAHGNCCGRVVSKNHFFKHSRAFLWFLLCNLVMNADAFAHSQLLINVQNQGGEVIQESITSNIGEDLITLEFQKTDGTLITQVIDFRNEVQILKALVLGEEERGQSQYQVMCFATKFNKGDFISSAAMAKLRQKNPHTIRTPEEDKGRETFTMSSWVQLNRSLPITRHLQGLCAEAMDATYVRDVDLKAWAELPGSSISSLEAATEKFPDTLSTRCNEVSSLWAPCLCNLETCIGWYPCGLKYCKGKGVAGADSSGAQQQAQPTNYRCGIKTCRKCTQFTYYVRQKQQCLWDEXRRGELQLMQMRCARRRNGSEFGDDASATCPGGETRAATTTATITGGGAGGSGKDTTAATTTTTNKLRQLLLLVQQQMPFALWSFPVHHISQSHHQSQSQHKPSRQQKQHQHHSQVAPTSHHQSSSSTPPTPSTSSSPPSSSSSSSSSAMAAIVA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of OAF_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of OAF_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of OAF_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of OAF_DROME !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...