UniProt ID | O10G3_HUMAN | |
---|---|---|
UniProt AC | Q8NGC4 | |
Protein Name | Olfactory receptor 10G3 | |
Gene Name | OR10G3 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 313 | |
Subcellular Localization |
Cell membrane Multi-pass membrane protein. |
|
Protein Description | Odorant receptor.. | |
Protein Sequence | MERINSTLLTAFILTGIPYPLRLRTLFFVFFFLIYILTQLGNLLILITVWADPRLHARPMYIFLGVLSVIDMSISSIIVPRLMMNFTLGVKPIPFGGCVAQLYFYHFLGSTQCFLYTLMAYDRYLAICQPLRYPVLMTAKLSALLVAGAWMAGSIHGALQAILTFRLPYCGPNQVDYFFCDIPAVLRLACADTTVNELVTFVDIGVVVASCFSLILLSYIQIIQAILRIHTADGRRRAFSTCGAHVTVVTVYYVPCAFIYLRPETNSPLDGAAALVPTAITPFLNPLIYTLRNQEVKLALKRMLRSPRTPSEV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
5 | N-linked_Glycosylation | ---MERINSTLLTAF ---CCHHHHHHHHHH | 34.85 | UniProtKB CARBOHYD | |
85 | N-linked_Glycosylation | IVPRLMMNFTLGVKP HHHHHHHCEEECCCC | 16.88 | UniProtKB CARBOHYD | |
138 | Phosphorylation | LRYPVLMTAKLSALL CCCCHHHHHHHHHHH | 19.24 | 24719451 | |
142 | Phosphorylation | VLMTAKLSALLVAGA HHHHHHHHHHHHHHH | 19.03 | - | |
154 | Phosphorylation | AGAWMAGSIHGALQA HHHHHHHCHHHHHHH | 11.24 | - | |
290 | Phosphorylation | FLNPLIYTLRNQEVK HHCHHHHHHCCHHHH | 16.55 | 24719451 | |
306 | Phosphorylation | ALKRMLRSPRTPSEV HHHHHHCCCCCCCCC | 18.12 | 17081983 | |
309 | Phosphorylation | RMLRSPRTPSEV--- HHHCCCCCCCCC--- | 34.25 | 27134283 | |
311 | Phosphorylation | LRSPRTPSEV----- HCCCCCCCCC----- | 50.83 | 27134283 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of O10G3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of O10G3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of O10G3_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of O10G3_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...