UniProt ID | NXPH4_HUMAN | |
---|---|---|
UniProt AC | O95158 | |
Protein Name | Neurexophilin-4 | |
Gene Name | NXPH4 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 308 | |
Subcellular Localization | Secreted . | |
Protein Description | May be signaling molecules that resemble neuropeptides and that act by binding to alpha-neurexins and possibly other receptors.. | |
Protein Sequence | MRLLPEWFLLLFGPWLLRKAVSAQIPESGRPQYLGLRPAAAGAGAPGQQLPEPRSSDGLGVGRAWSWAWPTNHTGALARAGAAGALPAQRTKRKPSIKAARAKKIFGWGDFYFRVHTLKFSLLVTGKIVDHVNGTFSVYFRHNSSSLGNLSVSIVPPSKRVEFGGVWLPGPVPHPLQSTLALEGVLPGLGPPLGMAAAAAGPGLGGSLGGALAGPLGGALGVPGAKESRAFNCHVEYEKTNRARKHRPCLYDPSQVCFTEHTQSQAAWLCAKPFKVICIFVSFLSFDYKLVQKVCPDYNFQSEHPYFG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
19 | Acetylation | FGPWLLRKAVSAQIP HHHHHHHHHHHCCCC | 53.78 | 25953088 | |
72 | N-linked_Glycosylation | WSWAWPTNHTGALAR EECCCCCCCHHHHHH | 27.00 | UniProtKB CARBOHYD | |
133 | N-linked_Glycosylation | GKIVDHVNGTFSVYF CEEEECCCCEEEEEE | 40.13 | UniProtKB CARBOHYD | |
143 | N-linked_Glycosylation | FSVYFRHNSSSLGNL EEEEEECCCCCCCEE | 39.05 | UniProtKB CARBOHYD | |
149 | N-linked_Glycosylation | HNSSSLGNLSVSIVP CCCCCCCEEEEEEEC | 34.14 | UniProtKB CARBOHYD | |
293 | Ubiquitination | FDYKLVQKVCPDYNF CCHHHHHHHCCCCCC | 38.02 | 29967540 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NXPH4_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NXPH4_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NXPH4_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of NXPH4_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...