dbPTM

NUP37_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	NUP37_MOUSE
UniProt AC	Q9CWU9
Protein Name	Nucleoporin Nup37
Gene Name	Nup37
Organism	Mus musculus (Mouse).
Sequence Length	326
Subcellular Localization	Chromosome, centromere, kinetochore. Nucleus, nuclear pore complex.
Protein Description	Component of the Nup107-160 subcomplex of the nuclear pore complex (NPC). The Nup107-160 subcomplex is required for the assembly of a functional NPC. The Nup107-160 subcomplex is also required for normal kinetochore microtubule attachment, mitotic progression and chromosome segregation (By similarity)..
Protein Sequence	MKQDATRNAAYTVDCEDYVHVVEFNPFESGDSGNLIAYGGSNYVVVGMCTFQEEETDIEGIQYKTLRTFHHGVRVDGIAWSPETKLDSLPPVIKFCTSAADLKIRLFTSDLQDKNEYKVLEGHSDFINDLVFHPKEGQELASVSDDHTCRIWNLEGKQTAHFLLHSPGMSVCWHPEETFKLMVAEKNGTIRFYDLMAQQAILSLQSEQTPLMSAHWCLKNTFKVGAVAGNDWIIWDITRSSYPQETRPVHMDRAHLFRWSAISENLFATTGYPGKMASQFQIHHLGHSQPVLIGSVAVGSGLSWHRTLPLCAVGGDHKLLFWVTEI

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
63	Phosphorylation	TDIEGIQYKTLRTFH CCCCCCEECEEEEEE	12.20	28059163
65	Phosphorylation	IEGIQYKTLRTFHHG CCCCEECEEEEEECC	19.28	22942356
114	Ubiquitination	FTSDLQDKNEYKVLE EECCCCCCCCEEEEE	38.42	22790023

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of NUP37_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of NUP37_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of NUP37_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of NUP37_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of NUP37_MOUSE

Related Literatures of Post-Translational Modification