UniProt ID | NUDT4_HUMAN | |
---|---|---|
UniProt AC | Q9NZJ9 | |
Protein Name | Diphosphoinositol polyphosphate phosphohydrolase 2 | |
Gene Name | NUDT4 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 180 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | Cleaves a beta-phosphate from the diphosphate groups in PP-InsP5 (diphosphoinositol pentakisphosphate), PP-InsP4 and [PP]2-InsP4 (bisdiphosphoinositol tetrakisphosphate), suggesting that it may play a role in signal transduction. Also able to catalyze the hydrolysis of dinucleoside oligophosphate Ap6A, but not Ap5A. The major reaction products are ADP and p4a from Ap6A. Also able to hydrolyze 5-phosphoribose 1-diphosphate. Does not play a role in U8 snoRNA decapping activity. Binds U8 snoRNA.. | |
Protein Sequence | MMKFKPNQTRTYDREGFKKRAACLCFRSEQEDEVLLVSSSRYPDQWIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGIFENQDRKHRTYVYVLTVTEILEDWEDSVNIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGCSPANGNSTVPSLPDNNALFVTAAQTSGLPSSVR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MMKFKPNQ -------CCCCCCCC | 6.26 | 22814378 | |
3 (in isoform 2) | Ubiquitination | - | 49.27 | - | |
3 | Ubiquitination | -----MMKFKPNQTR -----CCCCCCCCCC | 49.27 | - | |
5 | Ubiquitination | ---MMKFKPNQTRTY ---CCCCCCCCCCCC | 37.22 | - | |
38 | Phosphorylation | EDEVLLVSSSRYPDQ CCEEEEEECCCCCCC | 23.67 | 30206219 | |
39 | Phosphorylation | DEVLLVSSSRYPDQW CEEEEEECCCCCCCE | 16.03 | 30206219 | |
40 | Phosphorylation | EVLLVSSSRYPDQWI EEEEEECCCCCCCEE | 28.47 | 30206219 | |
53 | Sulfoxidation | WIVPGGGMEPEEEPG EECCCCCCCCCCCCC | 9.81 | 30846556 | |
68 | Phosphorylation | GAAVREVYEEAGVKG CHHHHHHHHHHCCCC | 11.87 | 28796482 | |
74 | Methylation | VYEEAGVKGKLGRLL HHHHHCCCCHHHHHH | 49.78 | - | |
74 (in isoform 2) | Ubiquitination | - | 49.78 | - | |
76 (in isoform 2) | Ubiquitination | - | 41.89 | - | |
76 | Methylation | EEAGVKGKLGRLLGI HHHCCCCHHHHHHEE | 41.89 | - | |
93 | Phosphorylation | NQDRKHRTYVYVLTV CCCCCCCEEEEEEEH | 19.63 | 22468782 | |
127 | Ubiquitination | FKVEDAIKVLQCHKP EEHHHHHHHHCCCCC | 38.32 | - | |
131 | S-nitrosylation | DAIKVLQCHKPVHAE HHHHHHCCCCCCCHH | 3.78 | 22178444 | |
133 | Ubiquitination | IKVLQCHKPVHAEYL HHHHCCCCCCCHHHH | 57.26 | - | |
134 (in isoform 2) | Ubiquitination | - | 10.24 | - | |
140 | Phosphorylation | KPVHAEYLEKLKLGC CCCCHHHHHHHCCCC | 3.35 | 27642862 | |
142 | Ubiquitination | VHAEYLEKLKLGCSP CCHHHHHHHCCCCCC | 48.61 | - | |
148 | Phosphorylation | EKLKLGCSPANGNST HHHCCCCCCCCCCCC | 25.83 | 22199227 | |
149 | Phosphorylation | KLKLGCSPANGNSTV HHCCCCCCCCCCCCC | 33.55 | 24719451 | |
154 | Phosphorylation | CSPANGNSTVPSLPD CCCCCCCCCCCCCCC | 31.98 | 25159151 | |
155 | Phosphorylation | SPANGNSTVPSLPDN CCCCCCCCCCCCCCC | 40.20 | 25159151 | |
158 | Phosphorylation | NGNSTVPSLPDNNAL CCCCCCCCCCCCCEE | 48.47 | 26074081 | |
335 | Phosphorylation | ------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------ | 27251275 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NUDT4_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NUDT4_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NUDT4_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of NUDT4_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...