UniProt ID | NUD22_HUMAN | |
---|---|---|
UniProt AC | Q9BRQ3 | |
Protein Name | Uridine diphosphate glucose pyrophosphatase | |
Gene Name | NUDT22 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 303 | |
Subcellular Localization | ||
Protein Description | Hydrolyzes UDP-glucose to glucose 1-phosphate and UMP and UDP-galactose to galactose 1-phosphate and UMP. Preferred substrate is UDP-glucose.. | |
Protein Sequence | MDPEVTLLLQCPGGGLPQEQIQAELSPAHDRRPLPGGDEAITAIWETRLKAQPWLFDAPKFRLHSATLAPIGSRGPQLLLRLGLTSYRDFLGTNWSSSAAWLRQQGATDWGDTQAYLADPLGVGAALATADDFLVFLRRSRQVAEAPGLVDVPGGHPEPQALCPGGSPQHQDLAGQLVVHELFSSVLQEICDEVNLPLLTLSQPLLLGIARNETSAGRASAEFYVQCSLTSEQVRKHYLSGGPEAHESTGIFFVETQNVQRLLETEMWAELCPSAKGAIILYNRVQGSPTGAALGSPALLPPL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
50 | Ubiquitination | AIWETRLKAQPWLFD HHHHHHHHCCCCCCC | 41.50 | 21906983 | |
50 | Ubiquitination | AIWETRLKAQPWLFD HHHHHHHHCCCCCCC | 41.50 | - | |
50 (in isoform 2) | Ubiquitination | - | 41.50 | 21890473 | |
57 (in isoform 1) | Ubiquitination | - | 60.84 | 21890473 | |
60 | Ubiquitination | PWLFDAPKFRLHSAT CCCCCCCCEEEEEEE | 44.85 | 23000965 | |
60 | Ubiquitination | PWLFDAPKFRLHSAT CCCCCCCCEEEEEEE | 44.85 | 21890473 | |
60 (in isoform 2) | Ubiquitination | - | 44.85 | 21890473 | |
67 (in isoform 1) | Ubiquitination | - | 26.85 | 21890473 | |
240 | Phosphorylation | QVRKHYLSGGPEAHE HHHHHHHCCCCCCCC | 34.24 | 24719451 | |
248 | Phosphorylation | GGPEAHESTGIFFVE CCCCCCCCCCEEEEE | 23.28 | 24719451 | |
288 | Phosphorylation | LYNRVQGSPTGAALG EEECCCCCCCCCCCC | 11.38 | 26852163 | |
290 | Phosphorylation | NRVQGSPTGAALGSP ECCCCCCCCCCCCCC | 40.94 | 26852163 | |
296 | Phosphorylation | PTGAALGSPALLPPL CCCCCCCCCCCCCCC | 14.09 | 28102081 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NUD22_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NUD22_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NUD22_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of NUD22_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...