| UniProt ID | NUD22_HUMAN | |
|---|---|---|
| UniProt AC | Q9BRQ3 | |
| Protein Name | Uridine diphosphate glucose pyrophosphatase | |
| Gene Name | NUDT22 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 303 | |
| Subcellular Localization | ||
| Protein Description | Hydrolyzes UDP-glucose to glucose 1-phosphate and UMP and UDP-galactose to galactose 1-phosphate and UMP. Preferred substrate is UDP-glucose.. | |
| Protein Sequence | MDPEVTLLLQCPGGGLPQEQIQAELSPAHDRRPLPGGDEAITAIWETRLKAQPWLFDAPKFRLHSATLAPIGSRGPQLLLRLGLTSYRDFLGTNWSSSAAWLRQQGATDWGDTQAYLADPLGVGAALATADDFLVFLRRSRQVAEAPGLVDVPGGHPEPQALCPGGSPQHQDLAGQLVVHELFSSVLQEICDEVNLPLLTLSQPLLLGIARNETSAGRASAEFYVQCSLTSEQVRKHYLSGGPEAHESTGIFFVETQNVQRLLETEMWAELCPSAKGAIILYNRVQGSPTGAALGSPALLPPL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 50 | Ubiquitination | AIWETRLKAQPWLFD HHHHHHHHCCCCCCC | 41.50 | 21906983 | |
| 50 | Ubiquitination | AIWETRLKAQPWLFD HHHHHHHHCCCCCCC | 41.50 | - | |
| 50 (in isoform 2) | Ubiquitination | - | 41.50 | 21890473 | |
| 57 (in isoform 1) | Ubiquitination | - | 60.84 | 21890473 | |
| 60 | Ubiquitination | PWLFDAPKFRLHSAT CCCCCCCCEEEEEEE | 44.85 | 23000965 | |
| 60 | Ubiquitination | PWLFDAPKFRLHSAT CCCCCCCCEEEEEEE | 44.85 | 21890473 | |
| 60 (in isoform 2) | Ubiquitination | - | 44.85 | 21890473 | |
| 67 (in isoform 1) | Ubiquitination | - | 26.85 | 21890473 | |
| 240 | Phosphorylation | QVRKHYLSGGPEAHE HHHHHHHCCCCCCCC | 34.24 | 24719451 | |
| 248 | Phosphorylation | GGPEAHESTGIFFVE CCCCCCCCCCEEEEE | 23.28 | 24719451 | |
| 288 | Phosphorylation | LYNRVQGSPTGAALG EEECCCCCCCCCCCC | 11.38 | 26852163 | |
| 290 | Phosphorylation | NRVQGSPTGAALGSP ECCCCCCCCCCCCCC | 40.94 | 26852163 | |
| 296 | Phosphorylation | PTGAALGSPALLPPL CCCCCCCCCCCCCCC | 14.09 | 28102081 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NUD22_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NUD22_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NUD22_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of NUD22_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
