| UniProt ID | NU4LM_HUMAN | |
|---|---|---|
| UniProt AC | P03901 | |
| Protein Name | NADH-ubiquinone oxidoreductase chain 4L | |
| Gene Name | MT-ND4L | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 98 | |
| Subcellular Localization |
Mitochondrion membrane Multi-pass membrane protein. |
|
| Protein Description | Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).. | |
| Protein Sequence | MPLIYMNIMLAFTISLLGMLVYRSHLMSSLLCLEGMMLSLFIMATLMTLNTHSLLANIVPIAMLVFAACEAAVGLALLVSISNTYGLDYVHNLNLLQC | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 5 | Phosphorylation | ---MPLIYMNIMLAF ---CCCHHHHHHHHH | 7.56 | 24043423 | |
| 13 | Phosphorylation | MNIMLAFTISLLGML HHHHHHHHHHHHHHH | 12.21 | 24043423 | |
| 15 | Phosphorylation | IMLAFTISLLGMLVY HHHHHHHHHHHHHHH | 17.93 | 24043423 | |
| 22 | Phosphorylation | SLLGMLVYRSHLMSS HHHHHHHHHHHHHHH | 11.48 | 24043423 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NU4LM_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NU4LM_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NU4LM_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| STAT1_HUMAN | STAT1 | physical | 21988832 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...