NU4LM_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NU4LM_HUMAN
• UniProt AC: P03901
• Protein Name: NADH-ubiquinone oxidoreductase chain 4L
• Gene Name: MT-ND4L
• Organism: Homo sapiens (Human).
• Sequence Length: 98
• Subcellular Localization: Mitochondrion membrane; Multi-pass membrane protein.
• Protein Description: Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity)..
• Protein Sequence: MPLIYMNIMLAFTISLLGMLVYRSHLMSSLLCLEGMMLSLFIMATLMTLNTHSLLANIVPIAMLVFAACEAAVGLALLVSISNTYGLDYVHNLNLLQC

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
5	Phosphorylation	---MPLIYMNIMLAF ---CCCHHHHHHHHH	7.56	24043423
13	Phosphorylation	MNIMLAFTISLLGML HHHHHHHHHHHHHHH	12.21	24043423
15	Phosphorylation	IMLAFTISLLGMLVY HHHHHHHHHHHHHHH	17.93	24043423
22	Phosphorylation	SLLGMLVYRSHLMSS HHHHHHHHHHHHHHH	11.48	24043423

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of NU4LM_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NU4LM_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NU4LM_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
STAT1_HUMAN	STAT1	physical	21988832

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.