UniProt ID | NTPCR_MOUSE | |
---|---|---|
UniProt AC | Q9CQA9 | |
Protein Name | Cancer-related nucleoside-triphosphatase homolog | |
Gene Name | Ntpcr | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 190 | |
Subcellular Localization | ||
Protein Description | Has nucleotide phosphatase activity towards ATP, GTP, CTP, TTP and UTP. Hydrolyzes nucleoside diphosphates with lower efficiency (By similarity).. | |
Protein Sequence | MSRHVFLTGPPGVGKTTLIQKAIEVLQSSGLPVDGFYTQEVRQEGKRIGFDVVTLSGAQGPLSRVGSQPLPGKPECRVGQYVVNLDSFEQLALPVLRNAGSSCGPKHRVCIIDEIGKMELFSQPFIQAVRQMLSTPGIIVVGTIPVPKGKPLALVEEIRKRRDVKVFNVTRDNRNSLLPDIVAVVQSSRT | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
67 | Phosphorylation | GPLSRVGSQPLPGKP CCHHHCCCCCCCCCC | 26.26 | 29514104 | |
165 | Acetylation | IRKRRDVKVFNVTRD HHHCCCCEEEEECCC | 45.45 | - | |
176 | Phosphorylation | VTRDNRNSLLPDIVA ECCCCCCCCCCHHHH | 28.22 | 26370283 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NTPCR_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NTPCR_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NTPCR_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of NTPCR_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...