NTF2B_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NTF2B_ARATH
• UniProt AC: Q9C7F5
• Protein Name: Nuclear transport factor 2B {ECO:0000303|PubMed:16428596}
• Gene Name: NTF2B {ECO:0000303|PubMed:16428596}
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 126
• Subcellular Localization: Cytoplasm . Nucleus . Nucleus envelope . Accumulates at the nuclear rim. Excluded from the nucleolus.
• Protein Description: Facilitates protein transport into the nucleus. Interacts with various nucleoporins and with Ran-GDP. Could be part of a multicomponent system of cytosolic factors that assemble at the pore complex during nuclear import..
• Protein Sequence: MSQMDPDAVSKAFVEHYYSTFDTNRVGLAGLYQEASMLTFEGQKIQGVQSIVAKLTSLPFQQCKHHISTVDCQPSGPASGMLVFVSGNLQLAGEEHALKFSQMFHLMPTPQGSFYVFNDIFRLNYA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MSQMDPDAV ------CCCCCHHHH		22223895
2	Phosphorylation	------MSQMDPDAV ------CCCCCHHHH		25561503

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of NTF2B_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NTF2B_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NTF2B_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
GSP1_YEAST	GSP1	physical	16428596
RAN_HUMAN	RAN	physical	16428596
RAN1_ARATH	RAN-1	physical	16428596

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.