UniProt ID | NTCP_HUMAN | |
---|---|---|
UniProt AC | Q14973 | |
Protein Name | Sodium/bile acid cotransporter | |
Gene Name | SLC10A1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 349 | |
Subcellular Localization |
Membrane Multi-pass membrane protein. |
|
Protein Description | The hepatic sodium/bile acid uptake system exhibits broad substrate specificity and transports various non-bile acid organic compounds as well. It is strictly dependent on the extracellular presence of sodium.; (Microbial infection) Acts as a receptor for hepatitis B virus.. | |
Protein Sequence | MEAHNASAPFNFTLPPNFGKRPTDLALSVILVFMLFFIMLSLGCTMEFSKIKAHLWKPKGLAIALVAQYGIMPLTAFVLGKVFRLKNIEALAILVCGCSPGGNLSNVFSLAMKGDMNLSIVMTTCSTFCALGMMPLLLYIYSRGIYDGDLKDKVPYKGIVISLVLVLIPCTIGIVLKSKRPQYMRYVIKGGMIIILLCSVAVTVLSAINVGKSIMFAMTPLLIATSSLMPFIGFLLGYVLSALFCLNGRCRRTVSMETGCQNVQLCSTILNVAFPPEVIGPLFFFPLLYMIFQLGEGLLLIAIFWCYEKFKTPKDKTKMIYTAATTEETIPGALGNGTYKGEDCSPCTA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
5 | N-linked_Glycosylation | ---MEAHNASAPFNF ---CCCCCCCCCCCC | 42.51 | UniProtKB CARBOHYD | |
11 | N-linked_Glycosylation | HNASAPFNFTLPPNF CCCCCCCCCCCCCCC | 28.12 | UniProtKB CARBOHYD | |
117 | N-linked_Glycosylation | LAMKGDMNLSIVMTT HHHCCCCCCCHHHHC | 35.06 | UniProtKB CARBOHYD | |
142 | Phosphorylation | PLLLYIYSRGIYDGD HHHHHHHHCCCCCCC | 17.93 | 24719451 | |
226 | Dephosphorylation | TPLLIATSSLMPFIG HHHHHHHHCHHHHHH | 16.68 | 16027164 | |
336 | N-linked_Glycosylation | TIPGALGNGTYKGED CCCCCCCCCCCCCCC | 40.25 | UniProtKB CARBOHYD | |
338 | Phosphorylation | PGALGNGTYKGEDCS CCCCCCCCCCCCCCC | 26.51 | - | |
339 | Phosphorylation | GALGNGTYKGEDCSP CCCCCCCCCCCCCCC | 20.56 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NTCP_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NTCP_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NTCP_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of NTCP_HUMAN !! |
Kegg Disease | |
---|---|
There are no disease associations of PTM sites. | |
OMIM Disease | |
There are no disease associations of PTM sites. | |
Kegg Drug | |
There are no disease associations of PTM sites. | |
DrugBank | |
DB00887 | Bumetanide |
DB02659 | Cholic Acid |
DB00286 | Conjugated Estrogens |
DB00091 | Cyclosporine |
DB00977 | Ethinyl Estradiol |
DB00328 | Indomethacin |
DB00279 | Liothyronine |
DB01583 | Liotrix |
DB08860 | Pitavastatin |
DB01032 | Probenecid |
DB00396 | Progesterone |
DB00624 | Testosterone |
DB01586 | Ursodeoxycholic acid |
loading...