| UniProt ID | NTCP_HUMAN | |
|---|---|---|
| UniProt AC | Q14973 | |
| Protein Name | Sodium/bile acid cotransporter | |
| Gene Name | SLC10A1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 349 | |
| Subcellular Localization |
Membrane Multi-pass membrane protein. |
|
| Protein Description | The hepatic sodium/bile acid uptake system exhibits broad substrate specificity and transports various non-bile acid organic compounds as well. It is strictly dependent on the extracellular presence of sodium.; (Microbial infection) Acts as a receptor for hepatitis B virus.. | |
| Protein Sequence | MEAHNASAPFNFTLPPNFGKRPTDLALSVILVFMLFFIMLSLGCTMEFSKIKAHLWKPKGLAIALVAQYGIMPLTAFVLGKVFRLKNIEALAILVCGCSPGGNLSNVFSLAMKGDMNLSIVMTTCSTFCALGMMPLLLYIYSRGIYDGDLKDKVPYKGIVISLVLVLIPCTIGIVLKSKRPQYMRYVIKGGMIIILLCSVAVTVLSAINVGKSIMFAMTPLLIATSSLMPFIGFLLGYVLSALFCLNGRCRRTVSMETGCQNVQLCSTILNVAFPPEVIGPLFFFPLLYMIFQLGEGLLLIAIFWCYEKFKTPKDKTKMIYTAATTEETIPGALGNGTYKGEDCSPCTA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 5 | N-linked_Glycosylation | ---MEAHNASAPFNF ---CCCCCCCCCCCC | 42.51 | UniProtKB CARBOHYD | |
| 11 | N-linked_Glycosylation | HNASAPFNFTLPPNF CCCCCCCCCCCCCCC | 28.12 | UniProtKB CARBOHYD | |
| 117 | N-linked_Glycosylation | LAMKGDMNLSIVMTT HHHCCCCCCCHHHHC | 35.06 | UniProtKB CARBOHYD | |
| 142 | Phosphorylation | PLLLYIYSRGIYDGD HHHHHHHHCCCCCCC | 17.93 | 24719451 | |
| 226 | Dephosphorylation | TPLLIATSSLMPFIG HHHHHHHHCHHHHHH | 16.68 | 16027164 | |
| 336 | N-linked_Glycosylation | TIPGALGNGTYKGED CCCCCCCCCCCCCCC | 40.25 | UniProtKB CARBOHYD | |
| 338 | Phosphorylation | PGALGNGTYKGEDCS CCCCCCCCCCCCCCC | 26.51 | - | |
| 339 | Phosphorylation | GALGNGTYKGEDCSP CCCCCCCCCCCCCCC | 20.56 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NTCP_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NTCP_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NTCP_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of NTCP_HUMAN !! | ||||
| Kegg Disease | |
|---|---|
| There are no disease associations of PTM sites. | |
| OMIM Disease | |
| There are no disease associations of PTM sites. | |
| Kegg Drug | |
| There are no disease associations of PTM sites. | |
| DrugBank | |
| DB00887 | Bumetanide |
| DB02659 | Cholic Acid |
| DB00286 | Conjugated Estrogens |
| DB00091 | Cyclosporine |
| DB00977 | Ethinyl Estradiol |
| DB00328 | Indomethacin |
| DB00279 | Liothyronine |
| DB01583 | Liotrix |
| DB08860 | Pitavastatin |
| DB01032 | Probenecid |
| DB00396 | Progesterone |
| DB00624 | Testosterone |
| DB01586 | Ursodeoxycholic acid |
loading...
