UniProt ID | NT5M_HUMAN | |
---|---|---|
UniProt AC | Q9NPB1 | |
Protein Name | 5'(3')-deoxyribonucleotidase, mitochondrial | |
Gene Name | NT5M | |
Organism | Homo sapiens (Human). | |
Sequence Length | 228 | |
Subcellular Localization | Mitochondrion . | |
Protein Description | Dephosphorylates specifically the 5' and 2'(3')-phosphates of uracil and thymine deoxyribonucleotides, and so protects mitochondrial DNA replication from excess dTTP. Has only marginal activity towards dIMP and dGMP.. | |
Protein Sequence | MIRLGGWCARRLCSAAVPAGRRGAAGGLGLAGGRALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRPC | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
120 | Phosphorylation | EAVKEMASLQNTDVF HHHHHHHHCCCCCEE | 29.22 | - | |
124 | Phosphorylation | EMASLQNTDVFICTS HHHHCCCCCEEEECC | 22.15 | - | |
137 | Acetylation | TSPIKMFKYCPYEKY CCCCCCHHCCCHHHH | 42.31 | 25953088 | |
166 | Phosphorylation | IVLTRDKTVVSADLL HHHCCCCEEEEEEEE | 30.35 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NT5M_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NT5M_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NT5M_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of NT5M_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...