NSE2_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NSE2_MOUSE
• UniProt AC: Q91VT1
• Protein Name: E3 SUMO-protein ligase NSE2
• Gene Name: Nsmce2
• Organism: Mus musculus (Mouse).
• Sequence Length: 247
• Subcellular Localization: Nucleus . Chromosome, telomere .
• Protein Description: E3 SUMO-protein ligase component of the SMC5-SMC6 complex, a complex involved in repair of DNA double-strand breaks by homologous recombination. Is not be required for the stability of the complex. The complex may promote sister chromatid homologous recombination by recruiting the SMC1-SMC3 cohesin complex to double-strand breaks. The complex is required for telomere maintenance via recombination and mediates sumoylation of shelterin complex (telosome) components. Acts as an E3 ligase mediating SUMO attachment to various proteins such as SMC6L1 and TRAX, the shelterin complex subunits TERF1, TERF2, TINF2 and TERF2IP, and maybe the cohesin components RAD21 and STAG2. Required for recruitment of telomeres to PML nuclear bodies. SUMO protein-ligase activity is required for the prevention of DNA damage-induced apoptosis by facilitating DNA repair. Required for sister chromatid cohesion during prometaphase and mitotic progression (By similarity)..
• Protein Sequence: MPGRSSTSSGSTRYISFSGIESALSSLKNFQSCISSGMDTVSSVALDLVETQTEVSSEYSMDKAMVEFAKMDRELSHYVKAVQSTINHVKEERPEKVPDLKLLVEKKFLALQDKNSDADFKENEKFVQFKQQLRELKKQYGIHADRENDLTEGVDEDMIVTQSQTNFICPITQLEMKKPVKNKMCGHTYEEEAIVRMIESKHKRKKKACCPKIGCSHTDMRMSDLIPDEALRRAIESHNKKKKRHSE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MPGRSSTS -------CCCCCCCC	7.77	-
14	Phosphorylation	TSSGSTRYISFSGIE CCCCCCEEEEECCHH	10.87	23984901
16	Phosphorylation	SGSTRYISFSGIESA CCCCEEEEECCHHHH	12.39	26745281
53	Phosphorylation	LDLVETQTEVSSEYS HHHHHHCCHHCCCCC	45.86	-
78	Phosphorylation	MDRELSHYVKAVQST HHHHHHHHHHHHHHH	10.56	29514104
116	Phosphorylation	LALQDKNSDADFKEN HHHCCCCCCCCHHHH	39.66	-
200	Phosphorylation	AIVRMIESKHKRKKK HHHHHHHHHHHHCCC	29.18	20139300
223	Phosphorylation	SHTDMRMSDLIPDEA CCCCCCHHHCCCHHH	20.92	28066266

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of NSE2_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NSE2_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NSE2_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of NSE2_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.