dbPTM

NRPD7_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	NRPD7_ARATH
UniProt AC	Q8LE42
Protein Name	DNA-directed RNA polymerase IV subunit 7
Gene Name	NRPD7
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	174
Subcellular Localization	Nucleus.
Protein Description	DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase IV which mediates 24-nt short-interfering RNAs (siRNA) accumulation. Implicated in siRNA-directed heterochromatin formation through the action of DCL3 and AGO4, and subsequent DNA methylation-dependent silencing of targeted sequences. Essential component of a self-reinforcing loop coupling de novo DNA methylation to siRNA production. Required for intercellular but not intracellular RNA interference (RNAi) leading to systemic post-transcriptional gene silencing. Involved in the maintenance of post-transcriptional RNA silencing..
Protein Sequence	MFIKVKLPWDVTIPAEDMDTGLMLQRAIVIRLLEAFSKEKATKDLGYLITPTILENIGEGKIKEQTGEIQFPVVFNGICFKMFKGEIVHGVVHKVHKTGVFLKSGPYEIIYLSHMKMPGYEFIPGENPFFMNQYMSRIQIGARVRFVVLDTEWREAEKDFMALASIDGDNLGPF

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of NRPD7_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of NRPD7_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of NRPD7_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of NRPD7_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of NRPD7_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of NRPD7_ARATH

Related Literatures of Post-Translational Modification