NRPB4_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NRPB4_ARATH
• UniProt AC: O48890
• Protein Name: DNA-directed RNA polymerase II subunit 4
• Gene Name: NRPB4
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 138
• Subcellular Localization: Nucleus.
• Protein Description: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Second largest component of RNA polymerase II which synthesizes mRNA precursors and many functional non-coding RNAs. Proposed to contribute to the polymerase catalytic activity and forms the polymerase active center together with the largest subunit. Pol II is the central component of the basal RNA polymerase II transcription machinery. It is composed of mobile elements that move relative to each other..
• Protein Sequence: MSGEEEENAAELKIGDEFLKAKCLMNCEVSLILEHKFEQLQQISEDPMNQVSQVFEKSLQYVKRFSRYKNPDAVRQVREILSRHQLTEFELCVLGNLCPETVEEAVAMVPSLKTKGRAHDDEAIEKMLNDLSLVKRFE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MSGEEEENA ------CCCHHHHHH		22223895
2	Phosphorylation	------MSGEEEENA ------CCCHHHHHH		25561503

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of NRPB4_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NRPB4_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NRPB4_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of NRPB4_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.