dbPTM

NRARP_XENLA - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	NRARP_XENLA
UniProt AC	Q5U5A6
Protein Name	Notch-regulated ankyrin repeat-containing protein
Gene Name	nrarp
Organism	Xenopus laevis (African clawed frog).
Sequence Length	114
Subcellular Localization
Protein Description	Promotes loss of intracellular domain (ICD) of Notch1 in embryos. By down-regulating ICD levels, could function as a negative feedback regulator of Notch signaling that attenuates ICD-mediated transcription. [PubMed: 11485984 Involved in angiogenesis. May be involved in somitogenesis (By similarity]
Protein Sequence	MSQAEMSTCSMPHTQRVFQEAVRNGNTKELHSLLQNMTNCEFNVNSFGPEGQTALHQSVIDGNLELVKLLVKFGADIRLANRDGWSALHIAAYGGHQDIVLYLITKAKYSSSSR

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of NRARP_XENLA !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of NRARP_XENLA !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of NRARP_XENLA !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of NRARP_XENLA !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
LEF1_HUMAN	LEF1	physical	16228014

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of NRARP_XENLA

Related Literatures of Post-Translational Modification