UniProt ID | NRARP_HUMAN | |
---|---|---|
UniProt AC | Q7Z6K4 | |
Protein Name | Notch-regulated ankyrin repeat-containing protein | |
Gene Name | NRARP | |
Organism | Homo sapiens (Human). | |
Sequence Length | 114 | |
Subcellular Localization | ||
Protein Description | Downstream effector of Notch signaling. Involved in the regulation of liver cancer cells self-renewal. [PubMed: 25985737 Involved in angiogenesis acting downstream of Notch at branch points to regulate vascular density. Proposed to integrate endothelial Notch and Wnt signaling to control stalk cell proliferation and to stablilize new endothelial connections during angiogenesis] | |
Protein Sequence | MSQAELSTCSAPQTQRIFQEAVRKGNTQELQSLLQNMTNCEFNVNSFGPEGQTALHQSVIDGNLELVKLLVKFGADIRLANRDGWSALHIAAFGGHQDIVLYLITKAKYAASGR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSQAELSTC ------CCHHHHHCC | 37.79 | 23684312 | |
7 | O-linked_Glycosylation | -MSQAELSTCSAPQT -CCHHHHHCCCCHHH | 20.90 | 29351928 | |
7 | Phosphorylation | -MSQAELSTCSAPQT -CCHHHHHCCCCHHH | 20.90 | 23684312 | |
8 | Phosphorylation | MSQAELSTCSAPQTQ CCHHHHHCCCCHHHH | 24.09 | 23684312 | |
10 | Phosphorylation | QAELSTCSAPQTQRI HHHHHCCCCHHHHHH | 42.97 | 23684312 | |
14 | Phosphorylation | STCSAPQTQRIFQEA HCCCCHHHHHHHHHH | 20.82 | 23684312 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NRARP_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NRARP_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NRARP_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of NRARP_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...