dbPTM

NRARP_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	NRARP_HUMAN
UniProt AC	Q7Z6K4
Protein Name	Notch-regulated ankyrin repeat-containing protein
Gene Name	NRARP
Organism	Homo sapiens (Human).
Sequence Length	114
Subcellular Localization
Protein Description	Downstream effector of Notch signaling. Involved in the regulation of liver cancer cells self-renewal. [PubMed: 25985737 Involved in angiogenesis acting downstream of Notch at branch points to regulate vascular density. Proposed to integrate endothelial Notch and Wnt signaling to control stalk cell proliferation and to stablilize new endothelial connections during angiogenesis]
Protein Sequence	MSQAELSTCSAPQTQRIFQEAVRKGNTQELQSLLQNMTNCEFNVNSFGPEGQTALHQSVIDGNLELVKLLVKFGADIRLANRDGWSALHIAAFGGHQDIVLYLITKAKYAASGR

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSQAELSTC ------CCHHHHHCC	37.79	23684312
7	O-linked_Glycosylation	-MSQAELSTCSAPQT -CCHHHHHCCCCHHH	20.90	29351928
7	Phosphorylation	-MSQAELSTCSAPQT -CCHHHHHCCCCHHH	20.90	23684312
8	Phosphorylation	MSQAELSTCSAPQTQ CCHHHHHCCCCHHHH	24.09	23684312
10	Phosphorylation	QAELSTCSAPQTQRI HHHHHCCCCHHHHHH	42.97	23684312
14	Phosphorylation	STCSAPQTQRIFQEA HCCCCHHHHHHHHHH	20.82	23684312

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of NRARP_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of NRARP_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of NRARP_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of NRARP_HUMAN !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of NRARP_HUMAN

Related Literatures of Post-Translational Modification