| UniProt ID | NPY4R_HUMAN | |
|---|---|---|
| UniProt AC | P50391 | |
| Protein Name | Neuropeptide Y receptor type 4 | |
| Gene Name | NPY4R | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 375 | |
| Subcellular Localization |
Cell membrane Multi-pass membrane protein. |
|
| Protein Description | Receptor for neuropeptide Y and peptide YY. The rank order of affinity of this receptor for pancreatic polypeptides is PP, PP (2-36) and [Ile-31, Gln-34] PP > [Pro-34] PYY > PYY and [Leu-31, Pro-34] NPY > NPY > PYY (3-36) and NPY (2-36) > PP (13-36) > PP (31-36) > NPY free acid.. | |
| Protein Sequence | MNTSHLLALLLPKSPQGENRSKPLGTPYNFSEHCQDSVDVMVFIVTSYSIETVVGVLGNLCLMCVTVRQKEKANVTNLLIANLAFSDFLMCLLCQPLTAVYTIMDYWIFGETLCKMSAFIQCMSVTVSILSLVLVALERHQLIINPTGWKPSISQAYLGIVLIWVIACVLSLPFLANSILENVFHKNHSKALEFLADKVVCTESWPLAHHRTIYTTFLLLFQYCLPLGFILVCYARIYRRLQRQGRVFHKGTYSLRAGHMKQVNVVLVVMVVAFAVLWLPLHVFNSLEDWHHEAIPICHGNLIFLVCHLLAMASTCVNPFIYGFLNTNFKKEIKALVLTCQQSAPLEESEHLPLSTVHTEVSKGSLRLSGRSNPI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | N-linked_Glycosylation | ------MNTSHLLAL ------CCHHHHHHH | 50.73 | UniProtKB CARBOHYD | |
| 3 | Phosphorylation | -----MNTSHLLALL -----CCHHHHHHHH | 19.07 | - | |
| 4 | Phosphorylation | ----MNTSHLLALLL ----CCHHHHHHHHC | 13.72 | - | |
| 14 | Phosphorylation | LALLLPKSPQGENRS HHHHCCCCCCCCCCC | 22.10 | - | |
| 19 | N-linked_Glycosylation | PKSPQGENRSKPLGT CCCCCCCCCCCCCCC | 61.42 | UniProtKB CARBOHYD | |
| 21 | Phosphorylation | SPQGENRSKPLGTPY CCCCCCCCCCCCCCC | 50.65 | 24719451 | |
| 29 | N-linked_Glycosylation | KPLGTPYNFSEHCQD CCCCCCCCHHHHCCC | 34.86 | UniProtKB CARBOHYD | |
| 187 | N-linked_Glycosylation | LENVFHKNHSKALEF HHHHHCCCHHHHHHH | 35.77 | UniProtKB CARBOHYD | |
| 190 | Ubiquitination | VFHKNHSKALEFLAD HHCCCHHHHHHHHHC | 49.82 | 29967540 | |
| 254 | Phosphorylation | VFHKGTYSLRAGHMK CCCCCCCEECCCCCC | 15.95 | 24719451 | |
| 334 | Ubiquitination | TNFKKEIKALVLTCQ CCHHHHHHHHHHHHC | 36.44 | 29967540 | |
| 340 | S-palmitoylation | IKALVLTCQQSAPLE HHHHHHHHCCCCCCC | 2.79 | - | |
| 363 | Ubiquitination | TVHTEVSKGSLRLSG EEEEEECCCCEECCC | 58.66 | 29967540 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NPY4R_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NPY4R_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NPY4R_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of NPY4R_HUMAN !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
