UniProt ID | NPM3_MOUSE | |
---|---|---|
UniProt AC | Q9CPP0 | |
Protein Name | Nucleoplasmin-3 | |
Gene Name | Npm3 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 175 | |
Subcellular Localization | Nucleus. | |
Protein Description | May act as a chaperone.. | |
Protein Sequence | MAAGAAAALAFLNQESRARAGGVGGLRVPAPVTMDSFFFGCELSGHTRSFTFKVEEEDDTEHVLALNMLCLTEGATDECNVVEVVARDHDNQEIAVPVANLRLSCQPMLSVDDFQLQPPVTFRLKSGSGPVRITGRHQIVCINNDLSEEESDDESEEDEIKLCGILPAKKHRGRP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MAAGAAAAL ------CHHHHHHHH | 18.01 | - | |
16 | Phosphorylation | LAFLNQESRARAGGV HHHHCHHHHHHCCCC | 22.83 | 22817900 | |
27 | Methylation | AGGVGGLRVPAPVTM CCCCCCCCCCCCEEE | 35.33 | - | |
41 | S-nitrosocysteine | MDSFFFGCELSGHTR ECEEEECEEECCCEE | 3.93 | - | |
41 | S-nitrosylation | MDSFFFGCELSGHTR ECEEEECEEECCCEE | 3.93 | 20925432 | |
147 | Phosphorylation | VCINNDLSEEESDDE EEEECCCCCCCCCCC | 45.91 | 27087446 | |
151 | Phosphorylation | NDLSEEESDDESEED CCCCCCCCCCCCHHH | 54.35 | 27087446 | |
155 | Phosphorylation | EEESDDESEEDEIKL CCCCCCCCHHHHHHH | 53.96 | 27087446 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NPM3_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NPM3_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NPM3_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of NPM3_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...