UniProt ID | NPFF_HUMAN | |
---|---|---|
UniProt AC | O15130 | |
Protein Name | Pro-FMRFamide-related neuropeptide FF | |
Gene Name | NPFF | |
Organism | Homo sapiens (Human). | |
Sequence Length | 113 | |
Subcellular Localization | Secreted. | |
Protein Description | Morphine modulating peptides. Have wide-ranging physiologic effects, including the modulation of morphine-induced analgesia, elevation of arterial blood pressure, and increased somatostatin secretion from the pancreas. Neuropeptide FF potentiates and sensitizes ASIC1 and ASIC3 channels.. | |
Protein Sequence | MDSRQAAALLVLLLLIDGGCAEGPGGQQEDQLSAEEDSEPLPPQDAQTSGSLLHYLLQAMERPGRSQAFLFQPQRFGRNTQGSWRNEWLSPRAGEGLNSQFWSLAAPQRFGKK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
76 | Phenylalanine amide | FLFQPQRFGRNTQGS EEECCCCCCCCCCCC | 10.18 | - | |
76 | Amidation | FLFQPQRFGRNTQGS EEECCCCCCCCCCCC | 10.18 | - | |
110 | Phenylalanine amide | SLAAPQRFGKK---- HHHCCHHHCCC---- | 16.51 | - | |
110 | Amidation | SLAAPQRFGKK---- HHHCCHHHCCC---- | 16.51 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NPFF_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NPFF_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NPFF_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of NPFF_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...