NPC2_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NPC2_DROME
• UniProt AC: Q9VQ62
• Protein Name: NPC intracellular cholesterol transporter 2 homolog a {ECO:0000305}
• Gene Name: Npc2a {ECO:0000312|FlyBase:FBgn0031381}
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 148
• Subcellular Localization: Secreted .
• Protein Description: Functions redundantly with Npc2b in regulating sterol homeostasis and ecdysteroid biosynthesis, probably by controlling the availability of sterol substrate..
• Protein Sequence: MLRYAVIACAALVVFAGALEFSDCGSKTGKFTRVAIEGCDTTKAECILKRNTTVSFSIDFALAEEATAVKTVVHGKVLGIEMPFPLANPDACVDSGLKCPLEKDESYRYTATLPVLRSYPKVSVLVKWELQDQDGADIICVEIPAKIQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
51	N-linked_Glycosylation	AECILKRNTTVSFSI EEEEEECCCEEEEEE	38.22	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of NPC2_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NPC2_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NPC2_DROME !!

Protein-Protein Interaction

Oops, there are no PPI records of NPC2_DROME !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.