NP1L5_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NP1L5_MOUSE
• UniProt AC: Q9JJF0
• Protein Name: Nucleosome assembly protein 1-like 5
• Gene Name: Nap1l5
• Organism: Mus musculus (Mouse).
• Sequence Length: 156
• Subcellular Localization: Nucleus .
• Protein Sequence: MADPEKQGPAESRAEDEVMEGAQGGEDAATGDSAAAPAAEEPQAPAENAPKPKKDFMESLPNSVKCRVLALKKLQKRCDKIEAKFDKEFQALEKKYNDIYKPLLAKIQELTGEMEGCAWTLEGEDDEDDEEEDDEEEEEEEEAAAGATGGPNFAKK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
54	Ubiquitination	ENAPKPKKDFMESLP CCCCCCCHHHHHHCC	65.80	22790023
63	Phosphorylation	FMESLPNSVKCRVLA HHHHCCCHHHHHHHH	22.48	29899451
65	Ubiquitination	ESLPNSVKCRVLALK HHCCCHHHHHHHHHH	19.02	22790023
84	Ubiquitination	RCDKIEAKFDKEFQA HHHHHHHHHHHHHHH	41.11	27667366
87	Ubiquitination	KIEAKFDKEFQALEK HHHHHHHHHHHHHHH	64.66	22790023
94	Ubiquitination	KEFQALEKKYNDIYK HHHHHHHHHHHHHHH	62.50	27667366
95	Ubiquitination	EFQALEKKYNDIYKP HHHHHHHHHHHHHHH	39.65	22790023
101	Ubiquitination	KKYNDIYKPLLAKIQ HHHHHHHHHHHHHHH	29.53	22790023

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of NP1L5_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NP1L5_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NP1L5_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of NP1L5_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.