| UniProt ID | NOP16_MOUSE | |
|---|---|---|
| UniProt AC | Q9CPT5 | |
| Protein Name | Nucleolar protein 16 | |
| Gene Name | Nop16 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 178 | |
| Subcellular Localization | Nucleus, nucleolus. | |
| Protein Description | ||
| Protein Sequence | MPKAKGKTRRQKFGYNVNRKRLNRNARRKAAPRIECSHIRHAWDHTKSVRQNLAEMGLAMDPNKAVPLRKKKVKAMEVDTEERPRDLVRKPYVVNDLEAEASLPEKKGNTLSRDLIDYVRYMVENHGEDYKAMARDEKNYYQDTPKQIRNKINVYKRFYPTEWQAFIDSLQSKKMEVD | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 8 | Phosphorylation | MPKAKGKTRRQKFGY CCCCCCCCHHHHHCC | 39.49 | - | |
| 64 | Acetylation | GLAMDPNKAVPLRKK CCCCCCCCCCCCCCC | 57.03 | 15606825 | |
| 90 | Acetylation | RPRDLVRKPYVVNDL CCHHHCCCCEEECCH | 32.97 | - | |
| 144 | Phosphorylation | EKNYYQDTPKQIRNK CCCCCCCCHHHHHHH | 19.50 | 24719451 | |
| 169 | Phosphorylation | EWQAFIDSLQSKKME HHHHHHHHHHHHCCC | 24.40 | - | |
| 173 | Acetylation | FIDSLQSKKMEVD-- HHHHHHHHCCCCC-- | 43.08 | 30986459 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NOP16_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NOP16_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NOP16_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of NOP16_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...