NOL12_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NOL12_MOUSE
• UniProt AC: Q8BG17
• Protein Name: Nucleolar protein 12
• Gene Name: Nol12
• Organism: Mus musculus (Mouse).
• Sequence Length: 217
• Subcellular Localization: Nucleus, nucleolus .
• Protein Description: May bind to 28S rRNA. In vitro binds single-stranded nucleic acids..
• Protein Sequence: MGRNKKKKKRDGDDRRPRLVLNFDEEKRREYLTGFHKRKVERKKAAIEEIKQRLKQEQKKLREERHQEYLKMLAEREEALEEADELERLVTAKTESVQYDHPNHTVTVTTISDLDLSGARLLGLPLPEQGDQDGSQEEEMSSLEKPTKALPRKSKDPLLSQRISSLTATLHAHSRKKVKRKHPRRAQDSTKKPPSATRTSKTQRRRRMTGKARHNGE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
44	Malonylation	KRKVERKKAAIEEIK HHHHHHHHHHHHHHH	49.63	26073543
135	Phosphorylation	EQGDQDGSQEEEMSS CCCCCCCCHHHHHHH	42.58	21659605
141	Phosphorylation	GSQEEEMSSLEKPTK CCHHHHHHHCCCCCC	34.74	28066266
142	Phosphorylation	SQEEEMSSLEKPTKA CHHHHHHHCCCCCCC	38.96	28066266
147	Phosphorylation	MSSLEKPTKALPRKS HHHCCCCCCCCCCCC	39.76	28066266

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of NOL12_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NOL12_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NOL12_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of NOL12_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.