dbPTM

NOL10_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	NOL10_SCHPO
UniProt AC	O74879
Protein Name	Ribosome biogenesis protein enp2 homolog
Gene Name	enp2
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	634
Subcellular Localization	Nucleus, nucleolus .
Protein Description	May be involved in rRNA-processing and ribosome biosynthesis..
Protein Sequence	MSLKVQNPNNVRVYTVSGEGVTQRLPNWISKRKLKKDYALSHRIELLQDFEYPEASNRIKCTRDGKYAMATGVYKPHIKVFDFAEMSLKFERHTDAENVQFEILSDDWTKSVHLQTDRTVDFHSQGGIHYSTRIPKYGRDLKYHYPNCDLYLAAAGDEVYRLNLEQGRFLNPLKIESAQIDSPTGGVNVIDINPMHQLLAFGTDAGSVEFWDPRDRSRVGILEIPSTVPSTPYSDNSRSVTALKYRNDGLNVAIGLSDGATLLYDLRSSSPYMSKDQGYSMPIKSLHWMDSALDGTARVLSADSKIIKIWEKDTGKPFSSIEPTVELNDVCPIEGTGLILTANEGSPMHAFYIPSLNPAPRWCSFLDNITEEMEENPAPTIYDDYKFVTKKELLNLGLDHLVGTGVIRAYMHGFFIDNNLYEKARLIANPFSYEEHRQKIVKERLEKQRASKIRSQNRPKVNAGLASRLSYQENKLRKKTGVTDGPSILEDERFKNVFTDKEFEVDEDTLEYKQLHPSRSEARGLTAAEESEEEKEHTKGIKFSSDEESLSDMEEENETFDALVDRRKTEQQVSNEKTPQETIRSTPSGMEMTFKVEKKKKSKPVNRDEDSTSGKKKQVTQGRRSASKNVFRNM

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
526	Phosphorylation	RSEARGLTAAEESEE HHHHCCCCHHHHCHH	27.01	21712547
531	Phosphorylation	GLTAAEESEEEKEHT CCCHHHHCHHHHHHC	41.64	28889911
551	Phosphorylation	SSDEESLSDMEEENE CCCHHHHHCHHHHHH	44.16	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of NOL10_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of NOL10_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of NOL10_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of NOL10_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of NOL10_SCHPO

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of fission yeast."; Wilson-Grady J.T., Villen J., Gygi S.P.; J. Proteome Res. 7:1088-1097(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-531, AND MASSSPECTROMETRY.	18257517 [Abstract]