NLTP5_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NLTP5_ARATH
• UniProt AC: Q9XFS7
• Protein Name: Non-specific lipid-transfer protein 5
• Gene Name: LTP5
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 118
• Protein Description: Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues (By similarity)..
• Protein Sequence: MEGLLKLSTLVIVCMLVTAPMASEAAISCGAVTGSLGQCYNYLTRGGFIPRGCCSGVQRLNSLARTTRDRQQACRCIQGAARALGSRLNAGRAARLPGACRVRISYPISARTNCNTVR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
62	Phosphorylation	SGVQRLNSLARTTRD HHHHHHHHHHHHHHH	28.18	21768351

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of NLTP5_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NLTP5_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NLTP5_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of NLTP5_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.