UniProt ID | NIPA2_HUMAN | |
---|---|---|
UniProt AC | Q8N8Q9 | |
Protein Name | Magnesium transporter NIPA2 | |
Gene Name | NIPA2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 360 | |
Subcellular Localization |
Cell membrane Multi-pass membrane protein . Early endosome. Recruited to the cell membrane in response to low extracellular magnesium.. |
|
Protein Description | Acts as a selective Mg(2+) transporter.. | |
Protein Sequence | MSQGRGKYDFYIGLGLAMSSSIFIGGSFILKKKGLLRLARKGSMRAGQGGHAYLKEWLWWAGLLSMGAGEVANFAAYAFAPATLVTPLGALSVLVSAILSSYFLNERLNLHGKIGCLLSILGSTVMVIHAPKEEEIETLNEMSHKLGDPGFVVFATLVVIVALILIFVVGPRHGQTNILVYITICSVIGAFSVSCVKGLGIAIKELFAGKPVLRHPLAWILLLSLIVCVSTQINYLNRALDIFNTSIVTPIYYVFFTTSVLTCSAILFKEWQDMPVDDVIGTLSGFFTIIVGIFLLHAFKDVSFSLASLPVSFRKDEKAMNGNLSNMYEVLNNNEESLTCGIEQHTGENVSRRNGNLTAF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
325 | Phosphorylation | KAMNGNLSNMYEVLN HHHCCCCCHHHHHHH | 24.45 | 27642862 | |
328 | Phosphorylation | NGNLSNMYEVLNNNE CCCCCHHHHHHHCCC | 13.72 | 28796482 | |
337 | Phosphorylation | VLNNNEESLTCGIEQ HHHCCCCCEEHEEEE | 23.85 | 26356563 | |
339 | Phosphorylation | NNNEESLTCGIEQHT HCCCCCEEHEEEECC | 20.26 | 26356563 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NIPA2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NIPA2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NIPA2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of NIPA2_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...