NIFU4_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NIFU4_ARATH
• UniProt AC: Q9LIG6
• Protein Name: NifU-like protein 4, mitochondrial
• Gene Name: NIFU4
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 283
• Subcellular Localization: Mitochondrion .
• Protein Description: Molecular scaffold for [Fe-S] cluster assembly of mitochondrial iron-sulfur proteins..
• Protein Sequence: MKGIARLVTSLSRIGGRKVVSGTSTVTSSSSSSLLLSRRSLFISATNLLNSRTKDSALPSLNSSLLAQKWNFLGGQRRTMFIQTQSTPNPSSLMFYPGKPVMEVGSADFPNVRSALGSPLAKSIYSIDGVVRVFFGSDFVTVTKSDDVSWDILKPEIFAAVMDFYSSGQPLFLDSQAAAAKDTAISEDDSETVAMIKELLETRIRPAVQDDGGDIEYCGFDPESGIVKLRMQGACSGCPSSSVTLKSGIENMLMHYVSEVKGVEQEFDGEDEEGTLSGEMRVE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
12	Phosphorylation	ARLVTSLSRIGGRKV HHHHHHHHHCCCEEE	22.94	24243849
195	Sulfoxidation	DDSETVAMIKELLET CCHHHHHHHHHHHHH	3.80	23289948
224	Phosphorylation	YCGFDPESGIVKLRM ECCCCCCCCEEEEEE	38.93	28011693

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of NIFU4_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NIFU4_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NIFU4_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.