NGN2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NGN2_HUMAN
• UniProt AC: Q9H2A3
• Protein Name: Neurogenin-2
• Gene Name: NEUROG2
• Organism: Homo sapiens (Human).
• Sequence Length: 272
• Subcellular Localization: Nucleus .
• Protein Description: Transcriptional regulator. Involved in neuronal differentiation. Activates transcription by binding to the E box (5'-CANNTG-3')..
• Protein Sequence: MFVKSETLELKEEEDVLVLLGSASPALAALTPLSSSADEEEEEEPGASGGARRQRGAEAGQGARGGVAAGAEGCRPARLLGLVHDCKRRPSRARAVSRGAKTAETVQRIKKTRRLKANNRERNRMHNLNAALDALREVLPTFPEDAKLTKIETLRFAHNYIWALTETLRLADHCGGGGGGLPGALFSEAVLLSPGGASAALSSSGDSPSPASTWSCTNSPAPSSSVSSNSTSPYSCTLSPASPAGSDMDYWQPPPPDKHRYAPHLPIARDCI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
5	Phosphorylation	---MFVKSETLELKE ---CCCCCCCEECCC	30.43	29759185
147	Ubiquitination	PTFPEDAKLTKIETL CCCCCCCCCCCHHHH	69.85	32142685
261	Phosphorylation	PPPDKHRYAPHLPIA CCCCCCCCCCCCCCC	24.97	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of NGN2_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NGN2_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NGN2_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of NGN2_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.