| UniProt ID | NEUT_HUMAN | |
|---|---|---|
| UniProt AC | P30990 | |
| Protein Name | Neurotensin/neuromedin N | |
| Gene Name | NTS | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 170 | |
| Subcellular Localization | Secreted. Cytoplasmic vesicle, secretory vesicle. Packaged within secretory vesicles. | |
| Protein Description | Neurotensin may play an endocrine or paracrine role in the regulation of fat metabolism. It causes contraction of smooth muscle.. | |
| Protein Sequence | MMAGMKIQLVCMLLLAFSSWSLCSDSEEEMKALEADFLTNMHTSKISKAHVPSWKMTLLNVCSLVNNLNSPAEETGEVHEEELVARRKLPTALDGFSLEAMLTIYQLHKICHSRAFQHWELIQEDILDTGNDKNGKEEVIKRKIPYILKRQLYENKPRRPYILKRDSYYY | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 146 | Phosphorylation | VIKRKIPYILKRQLY HHHHHHHHHHHHHHH | 23.51 | 22817900 | |
| 151 | Pyrrolidone_carboxylic_acid | IPYILKRQLYENKPR HHHHHHHHHHHCCCC | 46.97 | - | |
| 151 | Pyrrolidone_carboxylic_acid | IPYILKRQLYENKPR HHHHHHHHHHHCCCC | 46.97 | 19122660 | |
| 151 | Pyrrolidone_carboxylic_acid | IPYILKRQLYENKPR HHHHHHHHHHHCCCC | 46.97 | 19122660 | |
| 153 | Phosphorylation | YILKRQLYENKPRRP HHHHHHHHHCCCCCC | 14.76 | 22817900 | |
| 161 | Phosphorylation | ENKPRRPYILKRDSY HCCCCCCCCCCCCCC | 19.64 | - | |
| 168 | Phosphorylation | YILKRDSYYY----- CCCCCCCCCC----- | 15.86 | - | |
| 169 | Phosphorylation | ILKRDSYYY------ CCCCCCCCC------ | 13.47 | - | |
| 170 | Phosphorylation | LKRDSYYY------- CCCCCCCC------- | 12.12 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NEUT_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NEUT_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NEUT_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of NEUT_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
