UniProt ID | NEUT_HUMAN | |
---|---|---|
UniProt AC | P30990 | |
Protein Name | Neurotensin/neuromedin N | |
Gene Name | NTS | |
Organism | Homo sapiens (Human). | |
Sequence Length | 170 | |
Subcellular Localization | Secreted. Cytoplasmic vesicle, secretory vesicle. Packaged within secretory vesicles. | |
Protein Description | Neurotensin may play an endocrine or paracrine role in the regulation of fat metabolism. It causes contraction of smooth muscle.. | |
Protein Sequence | MMAGMKIQLVCMLLLAFSSWSLCSDSEEEMKALEADFLTNMHTSKISKAHVPSWKMTLLNVCSLVNNLNSPAEETGEVHEEELVARRKLPTALDGFSLEAMLTIYQLHKICHSRAFQHWELIQEDILDTGNDKNGKEEVIKRKIPYILKRQLYENKPRRPYILKRDSYYY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
146 | Phosphorylation | VIKRKIPYILKRQLY HHHHHHHHHHHHHHH | 23.51 | 22817900 | |
151 | Pyrrolidone_carboxylic_acid | IPYILKRQLYENKPR HHHHHHHHHHHCCCC | 46.97 | - | |
151 | Pyrrolidone_carboxylic_acid | IPYILKRQLYENKPR HHHHHHHHHHHCCCC | 46.97 | 19122660 | |
151 | Pyrrolidone_carboxylic_acid | IPYILKRQLYENKPR HHHHHHHHHHHCCCC | 46.97 | 19122660 | |
153 | Phosphorylation | YILKRQLYENKPRRP HHHHHHHHHCCCCCC | 14.76 | 22817900 | |
161 | Phosphorylation | ENKPRRPYILKRDSY HCCCCCCCCCCCCCC | 19.64 | - | |
168 | Phosphorylation | YILKRDSYYY----- CCCCCCCCCC----- | 15.86 | - | |
169 | Phosphorylation | ILKRDSYYY------ CCCCCCCCC------ | 13.47 | - | |
170 | Phosphorylation | LKRDSYYY------- CCCCCCCC------- | 12.12 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NEUT_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NEUT_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NEUT_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of NEUT_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...