UniProt ID | NEUM_MOUSE | |
---|---|---|
UniProt AC | P06837 | |
Protein Name | Neuromodulin | |
Gene Name | Gap43 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 227 | |
Subcellular Localization |
Cell membrane Peripheral membrane protein Cytoplasmic side. Cell projection, growth cone membrane Peripheral membrane protein Cytoplasmic side. Cell junction, synapse. Cell projection, filopodium membrane Peripheral membrane protein. Cytoplasmic |
|
Protein Description | This protein is associated with nerve growth. It is a major component of the motile "growth cones" that form the tips of elongating axons. Plays a role in axonal and dendritic filopodia induction.. | |
Protein Sequence | MLCCMRRTKQVEKNDEDQKIEQDGVKPEDKAHKAATKIQASFRGHITRKKLKGEKKGDAPAAEAEAKEKDDAPVADGVEKKEGDGSATTDAAPATSPKAEEPSKAGDAPSEEKKGEGDAAPSEEKAGSAETESAAKATTDNSPSSKAEDGPAKEEPKQADVPAAVTDAAATTPAAEDAATKAAQPPTETAESSQAEEEKDAVDEAKPKESARQDEGKEDPEADQEHA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | S-palmitoylation | -----MLCCMRRTKQ -----CCCCCCCCCC | 1.33 | 8399217 | |
4 | S-palmitoylation | ----MLCCMRRTKQV ----CCCCCCCCCCC | 1.78 | 8399217 | |
9 | Ubiquitination | LCCMRRTKQVEKNDE CCCCCCCCCCCCCHH | 51.00 | - | |
13 | Ubiquitination | RRTKQVEKNDEDQKI CCCCCCCCCHHHHHH | 71.49 | 27667366 | |
19 | Ubiquitination | EKNDEDQKIEQDGVK CCCHHHHHHHHCCCC | 61.61 | 22790023 | |
26 | Ubiquitination | KIEQDGVKPEDKAHK HHHHCCCCHHHHHHH | 48.49 | 27667366 | |
30 | Ubiquitination | DGVKPEDKAHKAATK CCCCHHHHHHHHHHH | 51.21 | 27667366 | |
36 | Phosphorylation | DKAHKAATKIQASFR HHHHHHHHHHHHHHH | 33.27 | 22817900 | |
37 | Ubiquitination | KAHKAATKIQASFRG HHHHHHHHHHHHHHC | 28.26 | 22790023 | |
41 | Phosphorylation | AATKIQASFRGHITR HHHHHHHHHHCCCCH | 10.09 | 23527152 | |
47 | Phosphorylation | ASFRGHITRKKLKGE HHHHCCCCHHHCCCC | 30.66 | 22324799 | |
56 | Ubiquitination | KKLKGEKKGDAPAAE HHCCCCCCCCCCHHH | 58.69 | 22790023 | |
67 | Ubiquitination | PAAEAEAKEKDDAPV CHHHHHHHHHCCCCC | 57.72 | 22790023 | |
69 | Ubiquitination | AEAEAKEKDDAPVAD HHHHHHHHCCCCCCC | 61.27 | 22790023 | |
80 | Ubiquitination | PVADGVEKKEGDGSA CCCCCCCEECCCCCC | 54.43 | 22790023 | |
81 | Ubiquitination | VADGVEKKEGDGSAT CCCCCCEECCCCCCC | 54.12 | 22790023 | |
86 | Phosphorylation | EKKEGDGSATTDAAP CEECCCCCCCCCCCC | 27.47 | 25521595 | |
88 | Phosphorylation | KEGDGSATTDAAPAT ECCCCCCCCCCCCCC | 27.23 | 25521595 | |
89 | Phosphorylation | EGDGSATTDAAPATS CCCCCCCCCCCCCCC | 24.29 | 22324799 | |
95 | Phosphorylation | TTDAAPATSPKAEEP CCCCCCCCCCCCCCC | 44.49 | 25521595 | |
96 | Phosphorylation | TDAAPATSPKAEEPS CCCCCCCCCCCCCCC | 26.89 | 25521595 | |
98 | Ubiquitination | AAPATSPKAEEPSKA CCCCCCCCCCCCCCC | 69.10 | 27667366 | |
103 | Phosphorylation | SPKAEEPSKAGDAPS CCCCCCCCCCCCCCC | 38.12 | 24925903 | |
104 | Ubiquitination | PKAEEPSKAGDAPSE CCCCCCCCCCCCCCH | 68.08 | 22790023 | |
110 | Phosphorylation | SKAGDAPSEEKKGEG CCCCCCCCHHHCCCC | 61.17 | 25521595 | |
113 | Ubiquitination | GDAPSEEKKGEGDAA CCCCCHHHCCCCCCC | 63.13 | 27667366 | |
114 | Ubiquitination | DAPSEEKKGEGDAAP CCCCHHHCCCCCCCC | 66.53 | 27667366 | |
122 | Phosphorylation | GEGDAAPSEEKAGSA CCCCCCCCHHHCCCC | 54.37 | 25521595 | |
125 | Ubiquitination | DAAPSEEKAGSAETE CCCCCHHHCCCCCHH | 54.73 | 22790023 | |
128 | Phosphorylation | PSEEKAGSAETESAA CCHHHCCCCCHHHHH | 28.00 | 25521595 | |
131 | Phosphorylation | EKAGSAETESAAKAT HHCCCCCHHHHHHHH | 34.65 | 20415495 | |
133 | Phosphorylation | AGSAETESAAKATTD CCCCCHHHHHHHHCC | 40.73 | 25521595 | |
136 | Ubiquitination | AETESAAKATTDNSP CCHHHHHHHHCCCCC | 46.08 | 22790023 | |
138 | Phosphorylation | TESAAKATTDNSPSS HHHHHHHHCCCCCCC | 33.69 | 24925903 | |
139 | Phosphorylation | ESAAKATTDNSPSSK HHHHHHHCCCCCCCC | 37.73 | 24925903 | |
142 | Phosphorylation | AKATTDNSPSSKAED HHHHCCCCCCCCCCC | 29.03 | 25521595 | |
144 | Phosphorylation | ATTDNSPSSKAEDGP HHCCCCCCCCCCCCC | 44.27 | 24925903 | |
145 | Phosphorylation | TTDNSPSSKAEDGPA HCCCCCCCCCCCCCC | 38.99 | 24925903 | |
146 | Ubiquitination | TDNSPSSKAEDGPAK CCCCCCCCCCCCCCC | 61.20 | 27667366 | |
153 | Ubiquitination | KAEDGPAKEEPKQAD CCCCCCCCCCCCCCC | 66.79 | 27667366 | |
166 | Phosphorylation | ADVPAAVTDAAATTP CCCCHHHCCHHHCCH | 18.39 | 24925903 | |
166 | O-linked_Glycosylation | ADVPAAVTDAAATTP CCCCHHHCCHHHCCH | 18.39 | 55412081 | |
171 | Phosphorylation | AVTDAAATTPAAEDA HHCCHHHCCHHHHHH | 28.69 | 25521595 | |
172 | Phosphorylation | VTDAAATTPAAEDAA HCCHHHCCHHHHHHH | 13.25 | 25521595 | |
180 | Phosphorylation | PAAEDAATKAAQPPT HHHHHHHHHHCCCCC | 23.96 | 24925903 | |
187 | Phosphorylation | TKAAQPPTETAESSQ HHHCCCCCHHHHHHH | 53.29 | 25521595 | |
189 | Phosphorylation | AAQPPTETAESSQAE HCCCCCHHHHHHHHH | 37.90 | 25521595 | |
192 | Phosphorylation | PPTETAESSQAEEEK CCCHHHHHHHHHHHH | 25.86 | 25521595 | |
193 | Phosphorylation | PTETAESSQAEEEKD CCHHHHHHHHHHHHH | 25.55 | 25521595 | |
199 | Ubiquitination | SSQAEEEKDAVDEAK HHHHHHHHHHCHHHC | 55.02 | 22790023 | |
217 | Ubiquitination | SARQDEGKEDPEADQ HHCCCCCCCCHHHHH | 57.82 | 27667366 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
41 | S | Phosphorylation | Kinase | PHK | - | Uniprot |
88 | T | Phosphorylation | Kinase | CSNK2A1 | P68400 | GPS |
89 | T | Phosphorylation | Kinase | CSNK2A1 | P68400 | GPS |
95 | T | Phosphorylation | Kinase | CSNK2A1 | P68400 | GPS |
96 | S | Phosphorylation | Kinase | JNK1 | P45983 | PSP |
192 | S | Phosphorylation | Kinase | CSNK2A1 | P68400 | GPS |
192 | S | Phosphorylation | Kinase | CK2 | - | Uniprot |
193 | S | Phosphorylation | Kinase | CSNK2A1 | P68400 | GPS |
193 | S | Phosphorylation | Kinase | CK2 | - | Uniprot |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NEUM_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NEUM_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Qualitative and quantitative analyses of protein phosphorylation innaive and stimulated mouse synaptosomal preparations."; Munton R.P., Tweedie-Cullen R., Livingstone-Zatchej M., Weinandy F.,Waidelich M., Longo D., Gehrig P., Potthast F., Rutishauser D.,Gerrits B., Panse C., Schlapbach R., Mansuy I.M.; Mol. Cell. Proteomics 6:283-293(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-95; SER-103 AND THR-172,AND MASS SPECTROMETRY. | |
"Phosphoproteomic analysis of the developing mouse brain."; Ballif B.A., Villen J., Beausoleil S.A., Schwartz D., Gygi S.P.; Mol. Cell. Proteomics 3:1093-1101(2004). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-96 AND THR-172, AND MASSSPECTROMETRY. | |
"Comprehensive identification of phosphorylation sites in postsynapticdensity preparations."; Trinidad J.C., Specht C.G., Thalhammer A., Schoepfer R.,Burlingame A.L.; Mol. Cell. Proteomics 5:914-922(2006). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-172, AND MASSSPECTROMETRY. |