UniProt ID | NEDD8_RAT | |
---|---|---|
UniProt AC | Q71UE8 | |
Protein Name | NEDD8 | |
Gene Name | Nedd8 | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 81 | |
Subcellular Localization | Nucleus. Mainly nuclear.. | |
Protein Description | Ubiquitin-like protein which plays an important role in cell cycle control and embryogenesis. Covalent attachment to its substrates requires prior activation by the E1 complex UBE1C-APPBP1 and linkage to the E2 enzyme UBE2M. Attachment of NEDD8 to cullins activates their associated E3 ubiquitin ligase activity, and thus promotes polyubiquitination and proteasomal degradation of cyclins and other regulatory proteins (By similarity).. | |
Protein Sequence | MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGGGGLGQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
4 | Acetylation | ----MLIKVKTLTGK ----CEEEEEECCCC | 33.45 | 22902405 | |
11 | Acetylation | KVKTLTGKEIEIDIE EEEECCCCEEEEECC | 50.73 | 22902405 | |
11 | Ubiquitination | KVKTLTGKEIEIDIE EEEECCCCEEEEECC | 50.73 | - | |
22 | Acetylation | IDIEPTDKVERIKER EECCCCHHHHHHHHH | 48.77 | 22902405 | |
22 | Ubiquitination | IDIEPTDKVERIKER EECCCCHHHHHHHHH | 48.77 | - | |
27 | Ubiquitination | TDKVERIKERVEEKE CHHHHHHHHHHHHHC | 45.77 | - | |
48 | Acetylation | QRLIYSGKQMNDEKT HHEEEECCCCCCCCC | 40.20 | 22902405 | |
48 | Ubiquitination | QRLIYSGKQMNDEKT HHEEEECCCCCCCCC | 40.20 | - | |
54 | Acetylation | GKQMNDEKTAADYKI CCCCCCCCCHHHHEE | 46.45 | 22902405 | |
54 | Ubiquitination | GKQMNDEKTAADYKI CCCCCCCCCHHHHEE | 46.45 | - | |
65 | Phosphorylation | DYKILGGSVLHLVLA HHEEHHHHHHHHHHH | 21.51 | 23984901 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NEDD8_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NEDD8_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NEDD8_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of NEDD8_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...