dbPTM

NDUV2_RAT - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	NDUV2_RAT
UniProt AC	P19234
Protein Name	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial
Gene Name	Ndufv2
Organism	Rattus norvegicus (Rat).
Sequence Length	248
Subcellular Localization	Mitochondrion inner membrane.
Protein Description	Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity)..
Protein Sequence	MFSLALRARASGLTAQWGRHARNLHKTAVQNGAGGALFVHRDTPENNPDTPFDFTPENYERIEAIVRNYPEGHRAAAVLPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYTMYNRKPVGKYHIQVCTTTPCMLRDSDSILETLQRKLGIKVGETTPDKLFTLIEVECLGACVNAPMVQINDDYYEDLTPKDIEEIIDELRAGKVPKPGPRSGRFCCEPAGGLTSLTEPPKGPGFGVQAGL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
144	O-linked_Glycosylation	TPCMLRDSDSILETL CCEECCCCHHHHHHH	27.16	27213235
158	Acetylation	LQRKLGIKVGETTPD HHHHHCCCCCCCCHH	42.25	22902405
192	Phosphorylation	VQINDDYYEDLTPKD EEECCCHHHCCCHHH	15.23	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
192	Y	Phosphorylation	Kinase	SRC	Q9WUD9	Uniprot

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of NDUV2_RAT !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of NDUV2_RAT !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of NDUV2_RAT !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of NDUV2_RAT

Related Literatures of Post-Translational Modification