UniProt ID | NDUS5_MOUSE | |
---|---|---|
UniProt AC | Q99LY9 | |
Protein Name | NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 | |
Gene Name | Ndufs5 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 106 | |
Subcellular Localization |
Mitochondrion inner membrane Peripheral membrane protein . Mitochondrion intermembrane space . |
|
Protein Description | Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.. | |
Protein Sequence | MPFLDIQKKLGISLDRHFMFLSAEQPYKNAARCHAFEKEWIECAHGIGGTRAKKECKIEFDDFEECLLRYKTMRRMHDIKKQREKLMKEGKYTPPPHHSGREEPRP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
8 | Succinylation | MPFLDIQKKLGISLD CCCHHHHHHHCCCCC | 50.75 | 23954790 | |
43 | S-nitrosylation | FEKEWIECAHGIGGT HHHHHHHHHCCCCCC | 2.20 | 22588120 | |
57 | Acetylation | TRAKKECKIEFDDFE CCCCCCCCCCCCCHH | 46.49 | 23864654 | |
66 | Glutathionylation | EFDDFEECLLRYKTM CCCCHHHHHHHHHHH | 3.23 | 24333276 | |
66 | S-nitrosylation | EFDDFEECLLRYKTM CCCCHHHHHHHHHHH | 3.23 | 24895380 | |
72 | Phosphorylation | ECLLRYKTMRRMHDI HHHHHHHHHHHHHHH | 13.64 | 23882026 | |
92 | Phosphorylation | KLMKEGKYTPPPHHS HHHHCCCCCCCCCCC | 35.02 | 22210690 | |
93 | Phosphorylation | LMKEGKYTPPPHHSG HHHCCCCCCCCCCCC | 32.57 | 25195567 | |
99 | Phosphorylation | YTPPPHHSGREEPRP CCCCCCCCCCCCCCC | 36.19 | 29899451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NDUS5_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NDUS5_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NDUS5_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of NDUS5_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...