| UniProt ID | NDUS4_MOUSE | |
|---|---|---|
| UniProt AC | Q9CXZ1 | |
| Protein Name | NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial | |
| Gene Name | Ndufs4 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 175 | |
| Subcellular Localization |
Mitochondrion inner membrane Peripheral membrane protein Matrix side . |
|
| Protein Description | Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.. | |
| Protein Sequence | MAAVSISVSLRQAMLGRRAMATAAVSVCRVPSRLLSTSTWKLADNQTRDTQLITVDEKLDITTLTGVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNMVLTFSAKEDAIAFAEKNGWSYDVEEKKVPKPKSKSYGANFSWNKRTRVSTK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 7 | Phosphorylation | -MAAVSISVSLRQAM -CCCEEEEHHHHHHH | 9.72 | 30387612 | |
| 9 | Phosphorylation | AAVSISVSLRQAMLG CCEEEEHHHHHHHHH | 15.84 | 22802335 | |
| 73 | Ubiquitination | GVPEEHIKTRKVRIF CCCHHHCCCCEEEEE | 44.15 | - | |
| 95 | Acetylation | QSGVNNTKKWKMEFD CCCCCCCCCEEEEEC | 59.78 | 160929 | |
| 95 | Succinylation | QSGVNNTKKWKMEFD CCCCCCCCCEEEEEC | 59.78 | 26388266 | |
| 96 | Succinylation | SGVNNTKKWKMEFDT CCCCCCCCEEEEECC | 50.43 | 26388266 | |
| 98 | Succinylation | VNNTKKWKMEFDTRE CCCCCCEEEEECCHH | 37.11 | 26388266 | |
| 144 | Phosphorylation | FAEKNGWSYDVEEKK HHHHHCCCCCCCCCC | 16.92 | 19060867 | |
| 150 | Acetylation | WSYDVEEKKVPKPKS CCCCCCCCCCCCCCC | 45.63 | 23864654 | |
| 150 | Succinylation | WSYDVEEKKVPKPKS CCCCCCCCCCCCCCC | 45.63 | 23954790 | |
| 154 | Acetylation | VEEKKVPKPKSKSYG CCCCCCCCCCCCCCC | 68.98 | 23201123 | |
| 168 | Acetylation | GANFSWNKRTRVSTK CCCCCCCCCCCCCCC | 49.22 | 2394853 | |
| 168 | Succinylation | GANFSWNKRTRVSTK CCCCCCCCCCCCCCC | 49.22 | 23954790 | |
| 173 | Phosphorylation | WNKRTRVSTK----- CCCCCCCCCC----- | 27.47 | 20433953 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NDUS4_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NDUS4_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NDUS4_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of NDUS4_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...