UniProt ID | NDUS4_ARATH | |
---|---|---|
UniProt AC | Q9FJW4 | |
Protein Name | NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial | |
Gene Name | FRO1 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 154 | |
Subcellular Localization |
Mitochondrion inner membrane Peripheral membrane protein Matrix side . |
|
Protein Description | Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).. | |
Protein Sequence | MALCATTQRTIRIAATLRRVARPFATDAVVESDYKRGEIGKVSGIPEEHLSRKVIIYSPARTATQSGSGKLGKWKINFVSTLKWENPLMGWTSTGDPYANVGDSALAFDSEEAAKSFAERHGWDYKVKKPNTPLLKVKSYSDNFKWKGNPQPEN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
58 | Phosphorylation | SRKVIIYSPARTATQ CCCEEEEECCCCCCC | 11.15 | 30589143 | |
132 | Phosphorylation | YKVKKPNTPLLKVKS CEECCCCCCCEEEEE | 24.68 | 25561503 | |
139 | Phosphorylation | TPLLKVKSYSDNFKW CCCEEEEECCCCCCC | 32.62 | 25561503 | |
140 | Phosphorylation | PLLKVKSYSDNFKWK CCEEEEECCCCCCCC | 17.83 | 25561503 | |
141 | Phosphorylation | LLKVKSYSDNFKWKG CEEEEECCCCCCCCC | 32.92 | 25561503 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NDUS4_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NDUS4_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NDUS4_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of NDUS4_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...