UniProt ID | NDUB7_MOUSE | |
---|---|---|
UniProt AC | Q9CR61 | |
Protein Name | NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 | |
Gene Name | Ndufb7 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 137 | |
Subcellular Localization |
Mitochondrion inner membrane Peripheral membrane protein . Mitochondrion intermembrane space . |
|
Protein Description | Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.. | |
Protein Sequence | MGAHLTRRYLWDASVEPDPEKIPSFPPDLGFPERKERVMVATQQEMMDAQLTLQQRDYCAHYLIRLLKCKRDSFPNFLACKHEQHDWDYCEHLDYVKRMKEFERERRLLQRKKRRALKEARVAQGQGEGEVGPEVAL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Myristoylation | ------MGAHLTRRY ------CCCCCCHHH | 23.00 | - | |
58 | Phosphorylation | LTLQQRDYCAHYLIR HHHHHHHHHHHHHHH | 8.17 | 25195567 | |
62 | Phosphorylation | QRDYCAHYLIRLLKC HHHHHHHHHHHHHHC | 5.82 | 25195567 | |
73 | Phosphorylation | LLKCKRDSFPNFLAC HHHCCCCCCCCCCCC | 46.79 | 26643407 | |
81 | Acetylation | FPNFLACKHEQHDWD CCCCCCCCCCCCCCC | 44.56 | 23201123 | |
89 | Phosphorylation | HEQHDWDYCEHLDYV CCCCCCCHHHHHHHH | 8.76 | 25195567 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NDUB7_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NDUB7_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NDUB7_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of NDUB7_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...