NDUB7_CAEEL - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NDUB7_CAEEL
• UniProt AC: P90789
• Protein Name: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7
• Gene Name: D2030.4
• Organism: Caenorhabditis elegans.
• Sequence Length: 123
• Subcellular Localization: Mitochondrion. Mitochondrion inner membrane; Peripheral membrane protein. Mitochondrion intermembrane space.
• Protein Description: Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity)..
• Protein Sequence: MGTKLSVSLEGASTPETAPRVDRPPTFDPQYGFERPRKVREMKATWEEMEQWKLKPAQRDYCAHHLISLMKCQTQNAPFAGHACDGERGAWDKCEYDDHIMRIKEFERERRLLQRQARKEATA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
14	Phosphorylation	VSLEGASTPETAPRV EECCCCCCCCCCCCC	25.30	28854356
31	Phosphorylation	PPTFDPQYGFERPRK CCCCCCCCCCCCCHH	29.21	27067626

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of NDUB7_CAEEL !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NDUB7_CAEEL !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NDUB7_CAEEL !!

Protein-Protein Interaction

Oops, there are no PPI records of NDUB7_CAEEL !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.